KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331991
Entry
4331991           CDS       T01015                                 
Name
(RefSeq) DNA repair protein UVH3 isoform X1
  KO
K10846  DNA excision repair protein ERCC-5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    4331991
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4331991
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     4331991
SSDB
Motif
Pfam: XPG_N XPG_I UBM
Other DBs
NCBI-GeneID: 4331991
NCBI-ProteinID: XP_015632826
UniProt: Q0DU61
LinkDB
Position
3:5508661..5517046
AA seq 1470 aa
MGVHGLWELLAPVGRRVSVETLAGKRLAVDASIWMVQFMRAMRDDKGDMIRDAHLLGFLR
RICKLLFLRARPVFVFDGATPALKRRTLAARRRHRDAAQAKVRKTAEKLLLSHLKARKLE
ELAAQIKSDRAKHDNKGKQVESSKMGEIEKINGEQKKNNDGENSGGIVAPIDQEKLDELL
AASLAAEEEANLTGKGKQYTVSVPLQEAADISEDDDEDDGEMIFPMTTGDIDPAVLASLP
PSMQLDLLVQMRERVMAENRQKYQKIKKEPAKFSELQIQSYLKTVAFRREIDEVQRGAAG
RGVGGVQTSKIASEANREFIFSSSFTGDKQTLAQRGGKEHIVDSIKSKREINPAVFKSNP
TSSSSSIKPNNSEPLGSFGPDVETYRDERGRIRVSRVKAMGIRMTRDIQRNLDFIKEHEQ
VRNRGHDSVVEGLANNEEPPDFPEHLFEGNGLRSSLHLSEDYDETASDNHHTSSLVGSDK
ISEGDYHGSKETIEISFADDQTEVKDNDDQIFLHLASGASSNLFTTEQTDGSDCITKEGV
LESETPPMQVDEKDHQASLMDNFCTDDEIEWEEGGCDVPGGPSSNENDQSKVPKGDLEED
ALVQEAIRRSLEDFKKQEHENVTPEDLQASFEDKPLQSYDDVPKPAGAAGKTADKIGKEI
NCEENDIVHGSLVVDGRENENQTQPENSDGHADMKRAYLLDPLPPCNMTASTSAAKSPEG
SEVQHHNSMLHSIRTPEWPKNDSDKVMTQYSLNSDNSKCKIDDSCTGETSRSLQNDLLMD
ELVPDTAVQKENMIQRTTDLSTSEINYTKLNDNVGIYSVSASNLEKELSLLRQEQEYLGN
ERRKLESHAESVSSEMFAECQELLQMFGLPYIIAPMEAEAQCAYMEMTNLVDGVVTDDSD
VFLFGARNVYKNIFDDRKYVETYLMKDIESELGLTREQLIRMAMLLGSDYTEGISGIGIV
NAIEVAHAFPEEDGLQKFREWVESPDPTLLGKLGMESGSSSKKKKSGRNHSDGKGNSLEP
EYAKGSDDSQSSNETQRIKEIFMSKHRNVSKNWHIPSTFPSEAVINAYISPQVDDSTEPF
SWGRPDSGLLRKLCWERFGWSKEKADELLIPVLREYNKHETQLRMEAFYSFNERFAKIRS
KRIKKAIKGITGKSFLETDELDHDSPSTSNTSKKKERTSSGRGRAKGQRTKDVGPGNTGN
QDYDIADSLVDAGEHTTEKSTSSKKRTANSSGGSRGKGRRSMNAAHVIIGNGEDSDVSNL
ASDEDSHIRHTNDYESEGLTLRRSNRKRKQVTYAEDGQEADDNDVSIHQIDENQGQGSLE
EDMCHMAGLDTQSNLLHQDTSELNIDQTHTDPSDMNEDPSGFELPEDCHTDTAPKDYLFT
GGGFCMEEGDEQDTGVDQSGAEMEHETRDACEGIDEVSESQSGKSMSYSATGEGTENANT
EARGASSSQGRNASRGSGAVPKLTKRRRKS
NT seq 4413 nt   +upstreamnt  +downstreamnt
atgggagtgcacgggctgtgggagctgctggctcccgtggggcggcgcgtgtcggtggag
accctggcggggaagcggctggcggtggacgcgagcatctggatggtgcagttcatgcgg
gcgatgcgggacgacaagggcgacatgatccgcgacgcccacctcctcgggttcctccgc
cgaatctgcaagctcctcttcctccgcgcgcgcccggtcttcgtcttcgacggcgccacc
ccggccctcaagcggcgcaccctcgccgcccgccgccgccaccgcgacgccgcccaggcc
aaggtccggaagaccgccgagaagctcctgctctcccatctcaaggctaggaagcttgaa
gaattggcagctcaaatcaagagtgacagggctaagcatgacaataaaggcaagcaagtt
gagagcagtaaaatgggagaaattgagaaaattaatggagagcaaaagaaaaacaacgat
ggagaaaacagcggggggattgtagcaccaatcgaccaggagaaactggatgaactgctg
gccgcatcacttgctgcagaggaagaggcaaatttgactggcaaaggaaaacagtatact
gtaagtgttccattgcaagaagcagctgacattagtgaggatgatgacgaggatgatgga
gagatgatctttcctatgacaacaggtgatattgatcctgcagtattagcttcactccct
ccatcaatgcagttggatcttcttgttcagatgagggagagagtgatggctgaaaacagg
cagaagtaccagaaaattaaaaaggaacctgcaaaattctcagagctccaaatacagtcg
tacctgaaaactgttgctttcaggcgagagatagatgaagttcagaggggtgctgcaggc
aggggtgttggaggcgtccaaacatcaaaaatagcatctgaagctaacagagagttcatt
ttctcatcatcattcactggtgataaacagacattagcacaaagaggcggaaaggagcat
attgtcgatagcattaaatcaaagagggaaatcaatcctgctgtcttcaaatccaatccc
actagtagttctagctcaattaagcctaacaacagtgagcctttggggagttttggacct
gatgttgagacatatcgtgatgagagaggaaggattagagtaagtagggtcaaagcaatg
ggaattcgtatgactcgtgatattcaaaggaatttggattttatcaaagagcatgaacag
gtcagaaacagggggcatgactctgtagttgaaggattagctaacaatgaagagcctcca
gattttccagaacatctttttgaaggtaatgggctgcggagttctcttcatctcagcgaa
gattatgatgaaactgctagcgataaccatcacacatcatcactagtaggatctgacaaa
atttctgagggtgattatcatggaagcaaagaaacaatagagatatcctttgctgacgat
caaacagaagtgaaggacaatgatgaccaaattttcttgcatttagcttctggagcttca
tccaacttattcactacagaacagactgatggctctgattgcattacaaaagaaggcgta
cttgaaagtgaaacacctcctatgcaagttgatgagaaggatcaccaagcatcactgatg
gacaatttctgtactgatgatgagatagagtgggaagaaggtggttgtgatgttcctgga
ggtccttccagtaatgaaaacgatcaatctaaagtaccgaaaggagatctagaagaagat
gcccttgttcaggaagctataaggagaagtttagaggattttaagaagcaagaacatgaa
aatgtgacccctgaagatttacaggcatcttttgaagacaaacctttgcaatcttatgat
gatgttcctaagccagctggagctgcaggaaagacagctgataaaattgggaaggaaata
aattgtgaagagaatgatatagtgcatggatcacttgtagttgatggacgagaaaacgag
aatcagactcaacccgagaatagtgatgggcatgccgatatgaagagagcttatttgttg
gatcctctccctccatgtaatatgaccgccagtactagtgctgcaaaatcacctgagggc
tcagaagttcagcaccacaattcaatgttacattcaatcagaactcccgagtggcctaag
aacgatagcgataaagttatgacgcaatacagtttgaattctgataattcaaagtgcaaa
atagatgattcttgtactggagaaacctcgaggtcactccaaaatgaccttttgatggat
gaactggttcctgacactgctgtacaaaaagaaaatatgatccagagaactacggactta
tccacatctgagataaactatacgaaactgaacgataatgttggtatatatagtgtgtca
gctagtaatctagaaaaggaattatctcttctgagacaggaacaagaatatctcggaaat
gaaaggcggaagcttgaaagccacgcagagtctgtcagcagtgagatgtttgctgaatgc
caggaattgcttcaaatgtttggcttgccatatataattgcacctatggaagctgaagct
cagtgtgcatacatggaaatgactaaccttgtcgatggagttgttactgatgattcagat
gttttcctgtttggtgcaaggaatgtttataagaacatatttgacgataggaaatatgtt
gaaacatacttaatgaaggacattgagtctgagcttggtctaacaagagaacaattaata
cgtatggcaatgcttcttgggagtgactacactgaaggaattagtggcattggcattgtg
aatgctattgaagttgcacacgcatttcctgaggaagatgggctccaaaagttcagggag
tgggttgaatcaccagatccaactttactgggaaaacttggtatggaaagtggtagcagc
tcaaagaaaaaaaagtctggcagaaatcattcagacggaaagggaaacagccttgagcct
gaatacgctaaaggttctgatgacagccaatcttctaatgagacccaacgcatcaaggaa
atatttatgagtaagcataggaatgtgagcaagaactggcatattccttctacttttcct
agtgaagcagtcataaacgcatatatttccccacaagttgatgattcaacagaaccattt
tcctggggaagaccagattcaggcttactgcgcaagttatgttgggaaaggtttgggtgg
agcaaggaaaaggctgatgaactgctaattcctgttttgagagagtataataagcacgag
actcaactacgcatggaggcgttttactcattcaatgagagatttgcaaaaattcgtagc
aaaaggattaagaaagctatcaagggtattacagggaaaagctttctagagacagatgaa
cttgatcatgatagtcccagtactagtaataccagcaagaagaaagagagaacctcctct
ggtcgtggtagggctaaagggcaaagaaccaaagatgttgggcctggtaacacaggaaat
caggactatgacattgctgatagcttagtagatgcaggtgaacatactacagaaaaaagc
acgtccagtaagaaaagaactgcaaactcctctggtggttcaagaggcaaaggaagaaga
agcatgaatgctgcacatgtgataattggaaatggggaagattctgatgtctctaattta
gcatctgatgaggattcccatattagacataccaacgactatgaatcagagggattgaca
ttacgcaggtcaaataggaagcgtaagcaggtcacatacgcggaagatggtcaggaagct
gatgataatgatgtttccatacatcaaatcgatgaaaatcagggccaaggttctttggag
gaggacatgtgtcacatggctggacttgacacacaatctaatctgctccatcaggatacg
agtgaattaaacatcgatcaaacgcatacagatccctctgatatgaacgaagatccttcg
ggctttgagttacccgaggattgccatacggacactgcaccaaaagactatctcttcacc
ggtggtggattctgcatggaagagggtgacgagcaagatacgggagtggatcaatctggt
gcagaaatggagcatgaaacacgtgatgcctgtgagggtattgacgaggtttctgaaagt
caaagcggtaaaagcatgagctattcggcgactggagagggcacagagaatgcaaataca
gaggcccgaggggcgtcttcatcgcagggacgcaatgcaagccgtggttcaggtgccgtg
ccgaagcttacaaagcgtaggagaaaatcatga

DBGET integrated database retrieval system