KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332068
Entry
4332068           CDS       T01015                                 
Name
(RefSeq) probable glucan 1,3-alpha-glucosidase
  KO
K05546  mannosyl-oligosaccharide alpha-1,3-glucosidase [EC:3.2.1.207]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
osa04141  Protein processing in endoplasmic reticulum
Module
osa_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4332068
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4332068
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.207  mannosyl-oligosaccharide alpha-1,3-glucosidase
     4332068
SSDB
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Other DBs
NCBI-GeneID: 4332068
NCBI-ProteinID: XP_015631638
UniProt: B9F676
LinkDB
Position
3:6127099..6131155
AA seq 919 aa
MDPPPRPRPHRVAVLLLLLLASSPAARAWKKDEFRNCNQTPFCKRARTRAPHSLDAPLSL
DAASLAVATDGSLTASLSHPSRLRPLLLRLSALPPHALRLQIDEDYSSNTPPHRRFQVPD
VLLPDVEARTLHLPQPKTSAAGVSTFALSSDVDVVVKHDPFELTVRRAGSGAPVLSFNSH
GLFDFEPLQESKQEGETWEEQFRSHTDTRPRGPQSITFDVSFYGADFVYGLPEHGSTSLA
LRPTRGPGAEESEPYRLFNLDVFEYLHESPFGLYGSIPFMIAHGDGPSSGFFWLNAAEMQ
IDVLAPGWDGASSTENGRIDTLWMAEAGVVDAFFFVGSEPKDVIKQYISVTGTPSMPQQF
AVAYHQCRWNYRDEEDVAGVDSGFDEHDIPYDVLWLDIEHTDGKRYFTWDHSAFPNPEVM
QGKIADKGRKMVTIVDPHIKRDSSFHLHEEATAKGYYVKDATGKDFDGWCWPGASSYPDM
LNPEIREWWADKFSYENYKGSTPTLYIWNDMNEPSVFNGPEVTMPRDAVHYGDVEHRELH
NAYGYYFHMATADGLLKRGEGKDRPFVLSRAFFAGSQRYGAIWTGDNSADWDHLKSSIPM
VLTLGLTGMTFSGADIGGFFGNPEPDLLVRWYQVGAFYPFFRGHAHHDTKRREPWLFGER
RTALMREAIHMRYSLLPYYYTLFREASVTGVPVMRPLWLEFPDDKETYNNGEAFMVGPSL
LAQGIYEEGQKSVSVYLPGEELWYDLRNGSPYKGGVSHKLEVSEDSIPSFQRAGAIVPRK
DRFRRSSTQMVNDPYTLVIALNSSSAAEGELYVDDGKSYDYQQGAFIHRRFVFADNKLTS
MNIAPKNLGNKKFSTECVIERIIILGVSSGSKKAIVEPGNHEVDIELGPISLRSGSSSVA
PTVRKPNVRVVDDWTIRIA
NT seq 2760 nt   +upstreamnt  +downstreamnt
atggatccgccgccgcggccgcgcccccaccgcgtcgccgtcctcctcctcctcctccta
gcctcctccccggccgcccgcgcctggaagaaggacgagttccgcaactgcaaccagacc
cccttctgcaagcgcgcgcgcacccgcgccccgcactcgctcgacgcgccgctctccctc
gacgccgcctcgctcgccgtcgccaccgacggctccctcaccgcctcgctctcccacccg
tcccgcctccgcccgctcctgctccgcctctccgcgctgcccccgcacgcgctccgcctc
cagatcgacgaggactactcgtccaacacgccgccgcaccgccgcttccaggtccccgac
gtgctcctcccggacgtcgaggcgcgcacgctccacctcccgcagcccaagacctccgcc
gccggcgtctccaccttcgcgctgtcctccgacgtcgacgtcgtcgtcaagcacgatccg
ttcgagctgaccgtccgccgcgccggctcgggggctcccgtcctctccttcaactcccac
ggcctcttcgacttcgagccgctgcaggagtccaagcaggagggcgagacctgggaggag
caattccggagccacaccgacacgcgcccacgcggcccgcagtccatcaccttcgacgtc
tccttctatggcgccgatttcgtctacggcctccccgagcacggctccacctcgctcgcc
ctccgccccacccgcggccccggggccgaggagtccgagccctatcgcctcttcaacctc
gacgtgtttgagtatctccacgagtcgcctttcgggttgtatgggtcaattcccttcatg
atcgcgcacggtgatggtccgtcctcagggttcttctggctaaacgccgcggagatgcag
atcgatgtgcttgcaccagggtgggatggagcctcgtccacagagaatgggcggatcgac
acgctatggatggccgaggctggtgttgttgatgccttcttcttcgttgggtctgagccg
aaggatgtgatcaagcagtacatcagtgtcacaggcacaccctcgatgccacagcagttt
gcggtggcgtatcaccagtgccgctggaactaccgtgatgaggaggatgttgccggagtg
gattctgggtttgatgagcatgatattccatatgatgtgctctggcttgacattgaacac
acagatggcaagcggtactttacatgggatcattcagcatttcctaacccagaggtgatg
caagggaagatagcagataaggggaggaagatggtcaccattgtagacccacatatcaag
cgagacagttcgttccacctccacgaggaagctactgctaagggatactatgtgaaagat
gcgactgggaaagacttcgatgggtggtgctggcctggggcatcgtcatatcctgacatg
ttaaaccctgagatacgagagtggtgggctgacaagttctcctatgaaaactacaaggga
tcaactccaacattgtatatctggaatgacatgaatgaaccatcagtcttcaatggccct
gaggtaaccatgccaagggatgcagtacattacggggatgttgagcacagagaactgcac
aacgcctacggatactacttccatatggctacagcagatggacttcttaagagaggtgaa
gggaaagacaggcccttcgttctgtcaagggccttctttgctggaagtcaacggtatgga
gcaatttggacgggcgacaactctgcagattgggaccaccttaaatcttctattccgatg
gttttaactcttggtcttactggcatgactttctctggtgcggacattggtggattcttt
ggcaacccagaacctgatcttttggtgcgttggtaccaagtaggagcattttatcctttc
tttagaggtcatgctcatcatgacaccaagagacgcgagccatggttatttggagagcga
agaactgctctcatgagggaggcaattcatatgcgatattctttgctgccatactattac
acactgttcagagaggctagtgtaactggtgttcctgtgatgcgtcctttatggttagaa
tttcctgatgacaaagagacatataataatggtgaggcttttatggttgggccaagcctt
ttagcacaaggaatttatgaagagggccagaaatcagtgtcagtgtaccttcctggagag
gagttatggtatgacttgagaaatggatctccatacaagggtggtgtgtcacacaagcta
gaagtttcagaagatagcattcccagtttccaaagggcaggcgcaattgtgccaagaaag
gatagattcaggcgcagttctactcagatggtgaatgatccatataccctggtgatagcg
ctcaatagctcaagtgcggcagaaggcgagctttatgtggatgatgggaagagttatgat
tatcagcaaggggcattcatccatcgtcgttttgtatttgcagacaataagctaacttcc
atgaatatcgcacccaaaaatcttggaaacaagaaattttcgaccgagtgcgtgattgaa
agaattataatccttggggtatcatcgggatcaaagaaggctattgttgaacctggaaat
catgaagtggatattgaattggggcctattagtctacgaagcggttcgagctctgttgca
ccaacagtacgaaagcccaatgttcgagttgtagatgattggactataaggatagcatga

DBGET integrated database retrieval system