KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332253
Entry
4332253           CDS       T01015                                 
Name
(RefSeq) enolase-like
  KO
K01689  enolase [EC:4.2.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4332253
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4332253
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4332253
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332253
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     4332253
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4332253
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4332253
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C Glyco_hydro_101
Other DBs
NCBI-GeneID: 4332253
NCBI-ProteinID: XP_015632611
UniProt: Q10P35 B9F6S8
LinkDB
Position
3:complement(7847994..7852818)
AA seq 445 aa
MAATIQSVKARQIFDSRGNPTVEVDICCSDGTFARAAVPSGASTGVYEALELRDGGSDYL
GKGVLKAVDNVNSIIGPALIGKDPTEQTVIDNFMVQQLDGTKNEWGWCKQKLGANAILAV
SLALCKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTG
ASSFKEAMKMGVEVYHNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIEKA
GYTGKVVIGMDVAASEFYTEDQTYDLNFKEENNDGSQKISGDSLKNVYKSFVSEYPIVSI
EDPFDQDDWVHYAKMTEEIGDQVQIVGDDLLVTNPTRVAKAIKDKACNALLLKVNQIGSV
TESIEAVKMSKRAGWGVMTSHRSGETEDTFIADLAVGLSTGQIKTGAPCRSERLAKYNQL
LRIEEELGAAAVYAGAKFRAPVEPY
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcggcgaccatccagagcgtgaaggcccgccagatcttcgacagccgtggcaacccc
accgtcgaggttgatatttgctgctcggatggaacatttgcgagggctgctgtgcctagc
ggtgcatctactggtgtatatgaagctttggaattgagggatggtggctctgattacttg
ggaaagggtgtcctcaaggctgttgacaatgtgaactctattattggaccagcattgatt
ggcaaggaccctacagaacagactgtcattgacaacttcatggttcagcaactggatgga
accaaaaacgagtggggctggtgcaagcaaaagcttggtgctaatgctatcctggctgtc
tcacttgctctatgcaaagccggagctattatcaagaaaattccgttgtatcaacacatt
gctaaccttgctggtaacaagcaacttgttttgcctgtgcctgctttcaatgtcatcaat
ggtggatcacatgctggaaacaagctagctatgcaggagttcatgatcctccctactggt
gcttcatctttcaaggaggctatgaagatgggtgttgaagtataccataacttaaagtct
gttatcaagaagaagtatgggcaagatgctactaatgttggtgatgaaggtggttttgct
ccaaacattcaggaaaacaaggagggccttgagcttttgaagactgcaattgaaaaggct
ggatacactggcaaggttgtcattgggatggatgttgctgcttcagagttctacactgag
gaccaaacctatgatcttaacttcaaggaagagaacaatgatggttcccagaagatatct
ggagatagcctgaagaatgtgtacaagtcatttgttagtgaatacccaattgtctcgatc
gaagacccatttgatcaggatgactgggttcactatgctaagatgaccgaagaaattgga
gatcaagtgcagattgttggagatgatctccttgtcaccaacccaactagggtagccaag
gcaattaaggacaaggcctgcaatgctcttctccttaaggttaaccaaattggatctgtt
actgagagcattgaggctgtcaagatgtcaaaacgtgctggctggggtgtgatgaccagt
cacaggagtggtgaaactgaggatacattcattgctgatctggcagttggtttatccacg
ggccagatcaagactggagctccttgcagatctgagcgccttgccaagtacaaccagctt
cttaggatcgaggaggagcttggtgctgctgccgtctatgccggagccaaattccgtgca
ccagtggagccctactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332356
Entry
4332356           CDS       T01015                                 
Name
(RefSeq) cytosolic enolase 3
  KO
K01689  enolase [EC:4.2.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4332356
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4332356
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4332356
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332356
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     4332356
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4332356
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4332356
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C
Other DBs
NCBI-GeneID: 4332356
NCBI-ProteinID: XP_015630469
UniProt: X5IB44
LinkDB
Position
3:complement(8800486..8805418)
AA seq 478 aa
MSVQEYLEKHLLSRKIEEAVNAAVRAKAPDPVLFISNHMRRAAPAVITSVRARQILDGRG
EPAVEVSLHTNKAVHRASAAAADAPEGAAADAVRDAEKRKLLARAVADAVRVINDKVSEA
LVGMDPQQQSQIDQAIMDLDKAHHKAEIGVNSMLAVSIAACKAGAAEKEVPLYKHIAELV
GKSATTLPIPAITVINGGTHAGNSLPIQEIMILPVGAKNFEEAMQMGSETYHHLKDIILE
KYGSNSCNIGDDGGFAPNISSITEGLDLVIEAINRAGYNGRIKLAIDVAATDFCMGNKYD
MEFKFAEKSGQGFKTADDLIEIYSQLCSEYPLVSIEQPFDKDDWEHSKKFTTLELCQVVG
DDLLMSDPERIKRAVNEYTCNALVLKANQVGTVTEAIEVVRQAKDAHWGVMVSHRSGDTD
DSFIADLAVGAAAGQIKAGAPCRGECLSKYNQLLRIEEELGSDGVYAGENWRTTASTS
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcggtgcaggagtacctggagaagcacctgctgtcgcgcaagatcgaggaggccgtg
aacgcggcggtccgcgccaaggcccccgacccggtgctcttcatctccaaccacatgcgc
cgggcggcgccggccgtgatcacgagcgtgcgggcgcgccagatcctcgacggccgcggg
gagcccgccgtggaggtcagcctccacaccaacaaggccgtgcaccgcgcctccgcggcc
gccgcggacgcccccgagggcgccgccgccgacgccgtcagggacgccgagaagcggaag
ctgctcgccagggcggtcgccgatgcggtgcgggtgatcaacgacaaggtgtcggaggcg
cttgtgggaatggatccgcagcagcagtcgcagatcgaccaggccatcatggacttggac
aaggcgcatcacaaggctgagattggagtgaattctatgttggctgtatcaattgcagct
tgtaaagcaggtgctgctgaaaaagaggttccattgtacaagcatatagcagaacttgtt
gggaaaagcgctacgacacttcccatccctgcaattacagtcattaatggaggaacacat
gctggaaacagtctccctattcaagaaattatgatccttcctgttggtgccaaaaacttt
gaagaagcaatgcagatgggttctgagacatatcatcatctgaaggatatcatcttggag
aaatatggttcaaacagctgcaacataggtgatgatggtggatttgctccaaatatttcc
agcataaccgaaggcttggatcttgtcattgaggcaataaatagagctggatataatgga
aggatcaagctagcaattgatgtcgccgctaccgatttttgcatgggaaataagtatgac
atggagttcaagtttgcagagaaatcagggcagggcttcaaaactgcagatgatttgatt
gagatttatagccagctttgttcagagtacccacttgtctcaatcgaacagccctttgat
aaagatgactgggagcattcgaagaagtttaccaccctagagctgtgccaggttgtaggt
gatgacttattgatgtcagatcccgaacgcattaagcgggcagtaaatgagtatacctgc
aatgctcttgttctcaaggctaatcaagtaggcactgtcacggaagccatagaggttgtg
agacaggcaaaggatgctcattggggcgtaatggtgtcacataggtccggggacactgat
gattctttcattgctgacttggctgttggtgctgctgctggacagatcaaagcgggtgct
ccttgccgtggagaatgtctcagtaaatacaatcagctgcttagaatagaggaagaactt
ggaagtgacggtgtttatgcaggggaaaattggagaaccaccgcaagcacaagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340042
Entry
4340042           CDS       T01015                                 
Name
(RefSeq) enolase 1
  KO
K01689  enolase [EC:4.2.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4340042
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4340042
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4340042
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4340042
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     4340042
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4340042
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4340042
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 4340042
NCBI-ProteinID: XP_015643741
UniProt: Q0DET2 Q5VNT9
LinkDB
Position
6:complement(1931299..1936389)
AA seq 446 aa
MAVTIQSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYL
GKGVLKAVSNVNTIIGPALIGKDPTEQVDIDNFMVQQLDGTSNNWGWCKQKLGANAILAV
SLAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTG
ASSFKEAMKMGVEVYHHLKSIIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKAAIAKA
GYTGKVVIGMDVAASEFYSEKDKTYDLNFKEDNNDGSHKISGDSLKDVYKSFVSEYPIVS
IEDPFDQDDWATYAKLTDEIGQQVQIVGDDLLVTNPTRVAKAISEKTCNALLLKVNQIGS
VTESIEAVRMSKRAGWGVMASHRSGETEDTFIADLSVGLSTGQIKTGAPCRSERLAKYNQ
LLRIEEELGDAAVYAGEKFRAPVEPY
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggcggtgacgatccagtccgtgaaggcgaggcagatcttcgacagccgcgggaacccc
acggtggaggtggacgtgggactcagcgatggcagcttcgcgaggggcgccgtgccgagc
ggtgcttccaccggaatatatgaggccttggagttaagagatggaggatccgactatctt
ggcaaaggtgtactcaaggctgtgagcaatgtaaacactattattgggccagcactcatc
ggaaaggatcccactgagcaagttgacattgataacttcatggttcaacagcttgatgga
acctccaacaactggggctggtgcaaacaaaagcttggagcaaatgctattcttgctgtt
tcacttgctgtgtgcaaagcaggagccatggtgaagaagattcccctttaccagcacatt
gcaaatcttgctggaaacaagactctcgtgctgcctgtacccgctttcaatgtgatcaat
ggaggatcccatgctggaaacaaacttgccatgcaggagttcatgatcctccctactggt
gcatcctctttcaaggaggccatgaagatgggagttgaggtgtaccaccacttgaagagt
ataatcaagaaaaagtatggccaagatgccacaaatgtgggggatgaaggtggctttgct
cctaacattcaggaaaacaaagagggcctcgaactgttgaaggccgcaatagctaaggct
ggctacacaggcaaagtggtcataggaatggatgttgcagcttctgaattttacagtgaa
aaggacaagacttacgatcttaacttcaaggaggataacaacgacggttcacacaaaatt
tcaggtgacagcctgaaagatgtgtacaagtcctttgtttctgagtaccctattgtgtcg
atcgaagatccattcgatcaggatgactgggctacctatgccaagcttactgatgagatt
ggacagcaagtgcagattgttggggatgaccttcttgttactaatcccacaagggttgcc
aaggcaattagtgaaaagacttgcaatgctcttctcttgaaggtgaatcaaataggctca
gttactgagagcattgaggctgttagaatgtccaagcgtgctggatggggagtgatggca
agccataggagtggtgagacagaggataccttcattgctgacctctcagttggtctgtct
acgggtcaaattaagacaggagctccctgtcggtcagagcgtctggctaaatacaaccag
ctgctcaggatagaagaagagctgggcgatgctgcagtttacgctggagaaaaattcaga
gcccctgtggagccgtactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346906
Entry
4346906           CDS       T01015                                 
Name
(RefSeq) enolase 1, chloroplastic
  KO
K01689  enolase [EC:4.2.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4346906
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4346906
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4346906
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4346906
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     4346906
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4346906
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4346906
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 4346906
NCBI-ProteinID: XP_015612055
UniProt: B7FA07
LinkDB
Position
9:complement(12540656..12544902)
AA seq 479 aa
MAHRLLLPTNPLLPPGTGTATPRRRPVAATVRAALATSAEEARAATGAEVVRSIRARQIV
DSRGNPTVEVDLVAGDGRLHRSAVPSGASTGIYEALELRDGDGAAYGGKGVLNAVRNINE
VIAPKLVGVDVRNQSDVDAIMLDIDGTPNKSKLGANAILGVSLSVCRAGAGAKEVPLYKH
IQELAGTKELVMPVPAFNVINGGSHAGNNLAMQEFMLLPVGASSFSEALRMGSEVYHALK
GIIKAKYGQDACNVGDEGGFAPNVQDNREGLVLLMDAIEKAGYSGKIKIGMDVAASEFLT
KDGSYDLNFKNQPNDGAHVLSAQRLCDLYKEFVKDFPIVSIEDPFDQDDWSSWASLQSSV
NIQIVGDDLLVTNPKRIAEAIGKKACNALLLKVNQIGTVTESIQAALDSKAAGWGVMVSH
RSGETEDNFIADLAVGLASGQIKTGAPCRSERLAKYNQLLRIEMELGNVRYAGEAFRSP
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcccaccgcctcctcctccccaccaaccccctcctgccccccggcaccggcaccgcc
accccgcggcggcgccccgtcgccgccaccgtccgcgcggcgctcgcgacgtcggcggag
gaggcgagggcggcgacgggggcggaggtggtgcggtcgatccgggcgaggcagatcgtg
gacagccgcgggaaccccaccgtggaggtcgacctcgtcgccggggacgggcggctgcac
cgctccgcggtgcccagcggcgcatccacggggatctacgaggcgctcgagctccgcgac
ggggacggggcggcgtacggcgggaagggcgtgctcaacgccgtccgcaacatcaacgag
gtcatcgcgcccaagctcgtcggcgtcgacgtcaggaaccagagtgatgttgatgcaatc
atgctagacattgatggaactccgaacaagtcaaaattgggtgccaatgctattcttgga
gtctctttaagcgtatgcagggctggtgctggtgcaaaggaagttcctttatataaacat
attcaggagttggctggaacaaaggagcttgtcatgcccgtcccagctttcaatgtaata
aatggaggtagccatgcgggcaacaatctggccatgcaggagttcatgcttttacctgtg
ggagcatcttcattttctgaggctcttcgcatgggtagtgaagtttaccatgccctaaag
ggcatcattaaggcgaaatatggtcaagatgcatgcaatgttggagatgaaggtggcttt
gctcctaatgttcaagacaacagagaaggccttgtcttgcttatggatgccattgagaag
gcaggctactctggaaagattaaaattggaatggatgttgcagcatcagagtttcttaca
aaggatggaagctatgacttaaactttaagaatcagcctaatgatggagctcatgttctt
tcagcccagcgtctctgtgatctgtacaaagaatttgtcaaggatttccccattgtatca
attgaggaccctttcgatcaagatgactggagctcatgggcatcattgcagtcttcagtt
aatatccaaattgtgggggatgatttactcgtcacgaacccaaaacgtattgcagaggct
attggcaagaaggcttgcaatgctcttttgctgaaggttaatcaaattggcactgtcact
gaatcaattcaagctgctcttgattcaaaagctgctggttggggcgtgatggtcagccac
aggagtggggaaacggaagataatttcatcgcagatctggctgttggtttagcaagtggt
cagatcaaaactggtgctccatgccgtagcgagagactggcaaagtacaatcagcttctg
cggatcgaaatggagctaggcaatgtgcgctatgctggggaggcattcaggtctccctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348176
Entry
4348176           CDS       T01015                                 
Name
(RefSeq) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4348176
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4348176
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4348176
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4348176
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     4348176
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4348176
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4348176
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 4348176
NCBI-ProteinID: XP_015614256
UniProt: Q42971
LinkDB
Position
10:complement(4639797..4644331)
AA seq 480 aa
MSRIHRNPTLLAPTPSPSSIPPLLEPSRSSPPPPMAATIVSVKARQIFDSRGNPTVEVDV
CCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGKGVSKAVDNVNSVIAPALIGKDPTS
QAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSLAICKAGAIIKKIPLYQHIANLAGN
KQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAASFKEAMKMGVEVYHNLKSVIKKKY
GQDATNVGDEGGFAPNIQENKEGLELLKTAIEKAGYTGKVVIGMDVAASEFYNDKDKTYD
LNFKEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQI
VGDDLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGE
TEDTFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgtctcgcatccatcgaaaccccactttattagcaccaaccccgtctccttcctccatt
cctccgctgctagaaccttctagaagctctcctcctcctcccatggcggcgacgatcgtg
tccgtcaaggcgcgccagatcttcgacagcaggggcaaccccaccgtcgaggtcgatgtg
tgctgctcagatggaacctttgcaagggctgcagttcccagtggtgcatcaactggtgtc
tatgaagctctcgaattgagggacggtggatctgattacttgggaaagggtgtttccaag
gctgtcgacaatgtgaactcggttattgccccagctctgattggcaaggaccctacgtca
caggctgagcttgataacttcatggttcagcagcttgatggaaccaaaaatgagtggggg
tggtgcaagcagaagcttggtgctaatgcaatcctggctgtgtcactggccatttgcaaa
gctggagctatcatcaagaagattcctctgtaccagcacattgccaaccttgctggaaac
aagcaactggttttgcccgtacctgcattcaacgtcattaacggtggatcacatgctgga
aacaagcttgccatgcaggagttcatgatccttcctactggggccgcttcattcaaggag
gccatgaagatgggtgttgaagtgtaccacaacctgaagtctgttatcaagaagaagtat
ggtcaggatgccaccaatgttggtgatgaaggtggttttgctcctaacattcaggaaaac
aaggagggtcttgagctcttgaagactgcaattgaaaaggctggatacactggcaaggtt
gtcattggaatggatgttgctgcttcggaattctacaatgacaaggacaaaacctatgac
cttaacttcaaggaggagaacaatgatggttcacaaaagatatctggtgatagcctgaag
aatgtatacaagtcatttgtcagtgaataccccattgtctcgattgaggatccgtttgac
caggatgactgggaacactatgctaagatgaccgctgaaattggagagcaagtgcagatt
gtcggtgatgacctccttgtcaccaacccaacaagggtggcaaaggcaatccaggagaag
tcatgcaatgctcttctgctgaaggttaaccaaattggatctgtcactgagagtattgag
gccgtgaagatgtcaaagcgtgctggctggggtgtgatgaccagccacaggagtggtgag
actgaggataccttcattgctgatttggctgttggtttggccacgggtcagatcaagact
ggagcaccctgccgatcagagcgccttgccaaatacaaccagcttcttaggattgaggag
gagcttggtgcggctgctgtctacgctggtgccaagttccgcgcacccgtggagccctac
taa

DBGET integrated database retrieval system