KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332253
Entry
4332253           CDS       T01015                                 
Name
(RefSeq) enolase-like
  KO
K01689  enolase 1/2/3 [EC:4.2.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
osa04820  Cytoskeleton in muscle cells
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4332253
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4332253
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    4332253
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4332253
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332253
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     4332253
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4332253
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4332253
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C Glyco_hydro_101
Other DBs
NCBI-GeneID: 4332253
NCBI-ProteinID: XP_015632611
UniProt: Q10P35 B9F6S8
LinkDB
Position
3:complement(join(7897948..7898028,7898234..7898290,7898423..7898474,7898572..7898660,7898744..7898794,7898882..7899076,7899154..7899231,7899335..7899397,7899788..7899862,7899940..7900020,7900108..7900209,7900311..7900391,7900498..7900584,7900664..7900711,7901299..7901363,7901548..7901611,7902236..7902304))
AA seq 445 aa
MAATIQSVKARQIFDSRGNPTVEVDICCSDGTFARAAVPSGASTGVYEALELRDGGSDYL
GKGVLKAVDNVNSIIGPALIGKDPTEQTVIDNFMVQQLDGTKNEWGWCKQKLGANAILAV
SLALCKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTG
ASSFKEAMKMGVEVYHNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIEKA
GYTGKVVIGMDVAASEFYTEDQTYDLNFKEENNDGSQKISGDSLKNVYKSFVSEYPIVSI
EDPFDQDDWVHYAKMTEEIGDQVQIVGDDLLVTNPTRVAKAIKDKACNALLLKVNQIGSV
TESIEAVKMSKRAGWGVMTSHRSGETEDTFIADLAVGLSTGQIKTGAPCRSERLAKYNQL
LRIEEELGAAAVYAGAKFRAPVEPY
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcggcgaccatccagagcgtgaaggcccgccagatcttcgacagccgtggcaacccc
accgtcgaggttgatatttgctgctcggatggaacatttgcgagggctgctgtgcctagc
ggtgcatctactggtgtatatgaagctttggaattgagggatggtggctctgattacttg
ggaaagggtgtcctcaaggctgttgacaatgtgaactctattattggaccagcattgatt
ggcaaggaccctacagaacagactgtcattgacaacttcatggttcagcaactggatgga
accaaaaacgagtggggctggtgcaagcaaaagcttggtgctaatgctatcctggctgtc
tcacttgctctatgcaaagccggagctattatcaagaaaattccgttgtatcaacacatt
gctaaccttgctggtaacaagcaacttgttttgcctgtgcctgctttcaatgtcatcaat
ggtggatcacatgctggaaacaagctagctatgcaggagttcatgatcctccctactggt
gcttcatctttcaaggaggctatgaagatgggtgttgaagtataccataacttaaagtct
gttatcaagaagaagtatgggcaagatgctactaatgttggtgatgaaggtggttttgct
ccaaacattcaggaaaacaaggagggccttgagcttttgaagactgcaattgaaaaggct
ggatacactggcaaggttgtcattgggatggatgttgctgcttcagagttctacactgag
gaccaaacctatgatcttaacttcaaggaagagaacaatgatggttcccagaagatatct
ggagatagcctgaagaatgtgtacaagtcatttgttagtgaatacccaattgtctcgatc
gaagacccatttgatcaggatgactgggttcactatgctaagatgaccgaagaaattgga
gatcaagtgcagattgttggagatgatctccttgtcaccaacccaactagggtagccaag
gcaattaaggacaaggcctgcaatgctcttctccttaaggttaaccaaattggatctgtt
actgagagcattgaggctgtcaagatgtcaaaacgtgctggctggggtgtgatgaccagt
cacaggagtggtgaaactgaggatacattcattgctgatctggcagttggtttatccacg
ggccagatcaagactggagctccttgcagatctgagcgccttgccaagtacaaccagctt
cttaggatcgaggaggagcttggtgctgctgccgtctatgccggagccaaattccgtgca
ccagtggagccctactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332356
Entry
4332356           CDS       T01015                                 
Name
(RefSeq) cytosolic enolase 3
  KO
K01689  enolase 1/2/3 [EC:4.2.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
osa04820  Cytoskeleton in muscle cells
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4332356
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4332356
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    4332356
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4332356
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332356
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     4332356
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4332356
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4332356
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C RNA_pol_Rpb6
Other DBs
NCBI-GeneID: 4332356
NCBI-ProteinID: XP_015630469
UniProt: X5IB44
LinkDB
Position
3:complement(join(8850998..8851078,8851257..8851454,8852032..8852118,8852187..8852272,8852363..8852461,8853139..8853242,8853348..8853424,8853736..8853816,8854065..8854181,8854278..8854349,8854714..8855148))
AA seq 478 aa
MSVQEYLEKHLLSRKIEEAVNAAVRAKAPDPVLFISNHMRRAAPAVITSVRARQILDGRG
EPAVEVSLHTNKAVHRASAAAADAPEGAAADAVRDAEKRKLLARAVADAVRVINDKVSEA
LVGMDPQQQSQIDQAIMDLDKAHHKAEIGVNSMLAVSIAACKAGAAEKEVPLYKHIAELV
GKSATTLPIPAITVINGGTHAGNSLPIQEIMILPVGAKNFEEAMQMGSETYHHLKDIILE
KYGSNSCNIGDDGGFAPNISSITEGLDLVIEAINRAGYNGRIKLAIDVAATDFCMGNKYD
MEFKFAEKSGQGFKTADDLIEIYSQLCSEYPLVSIEQPFDKDDWEHSKKFTTLELCQVVG
DDLLMSDPERIKRAVNEYTCNALVLKANQVGTVTEAIEVVRQAKDAHWGVMVSHRSGDTD
DSFIADLAVGAAAGQIKAGAPCRGECLSKYNQLLRIEEELGSDGVYAGENWRTTASTS
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcggtgcaggagtacctggagaagcacctgctgtcgcgcaagatcgaggaggccgtg
aacgcggcggtccgcgccaaggcccccgacccggtgctcttcatctccaaccacatgcgc
cgggcggcgccggccgtgatcacgagcgtgcgggcgcgccagatcctcgacggccgcggg
gagcccgccgtggaggtcagcctccacaccaacaaggccgtgcaccgcgcctccgcggcc
gccgcggacgcccccgagggcgccgccgccgacgccgtcagggacgccgagaagcggaag
ctgctcgccagggcggtcgccgatgcggtgcgggtgatcaacgacaaggtgtcggaggcg
cttgtgggaatggatccgcagcagcagtcgcagatcgaccaggccatcatggacttggac
aaggcgcatcacaaggctgagattggagtgaattctatgttggctgtatcaattgcagct
tgtaaagcaggtgctgctgaaaaagaggttccattgtacaagcatatagcagaacttgtt
gggaaaagcgctacgacacttcccatccctgcaattacagtcattaatggaggaacacat
gctggaaacagtctccctattcaagaaattatgatccttcctgttggtgccaaaaacttt
gaagaagcaatgcagatgggttctgagacatatcatcatctgaaggatatcatcttggag
aaatatggttcaaacagctgcaacataggtgatgatggtggatttgctccaaatatttcc
agcataaccgaaggcttggatcttgtcattgaggcaataaatagagctggatataatgga
aggatcaagctagcaattgatgtcgccgctaccgatttttgcatgggaaataagtatgac
atggagttcaagtttgcagagaaatcagggcagggcttcaaaactgcagatgatttgatt
gagatttatagccagctttgttcagagtacccacttgtctcaatcgaacagccctttgat
aaagatgactgggagcattcgaagaagtttaccaccctagagctgtgccaggttgtaggt
gatgacttattgatgtcagatcccgaacgcattaagcgggcagtaaatgagtatacctgc
aatgctcttgttctcaaggctaatcaagtaggcactgtcacggaagccatagaggttgtg
agacaggcaaaggatgctcattggggcgtaatggtgtcacataggtccggggacactgat
gattctttcattgctgacttggctgttggtgctgctgctggacagatcaaagcgggtgct
ccttgccgtggagaatgtctcagtaaatacaatcagctgcttagaatagaggaagaactt
ggaagtgacggtgtttatgcaggggaaaattggagaaccaccgcaagcacaagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340042
Entry
4340042           CDS       T01015                                 
Name
(RefSeq) enolase 1
  KO
K01689  enolase 1/2/3 [EC:4.2.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
osa04820  Cytoskeleton in muscle cells
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4340042
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4340042
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    4340042
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4340042
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4340042
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     4340042
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4340042
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4340042
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 4340042
NCBI-ProteinID: NP_001407993
UniProt: Q0DET2 Q5VNT9
LinkDB
Position
6:complement(join(2088916..2088996,2089460..2089516,2089600..2089651,2089737..2089825,2089915..2089965,2090060..2090254,2090379..2090459,2090569..2090631,2091409..2091483,2091558..2091638,2091717..2091818,2091900..2091980,2092085..2092171,2092284..2092331,2092721..2092785,2093366..2093429,2093584..2093652))
AA seq 446 aa
MAVTIQSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYL
GKGVLKAVSNVNTIIGPALIGKDPTEQVDIDNFMVQQLDGTSNNWGWCKQKLGANAILAV
SLAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTG
ASSFKEAMKMGVEVYHHLKSIIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKAAIAKA
GYTGKVVIGMDVAASEFYSEKDKTYDLNFKEDNNDGSHKISGDSLKDVYKSFVSEYPIVS
IEDPFDQDDWATYAKLTDEIGQQVQIVGDDLLVTNPTRVAKAISEKTCNALLLKVNQIGS
VTESIEAVRMSKRAGWGVMASHRSGETEDTFIADLSVGLSTGQIKTGAPCRSERLAKYNQ
LLRIEEELGDAAVYAGEKFRAPVEPY
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggcggtgacgatccagtccgtgaaggcgaggcagatcttcgacagccgcgggaacccc
acggtggaggtggacgtgggactcagcgatggcagcttcgcgaggggcgccgtgccgagc
ggtgcttccaccggaatatatgaggccttggagttaagagatggaggatccgactatctt
ggcaaaggtgtactcaaggctgtgagcaatgtaaacactattattgggccagcactcatc
ggaaaggatcccactgagcaagttgacattgataacttcatggttcaacagcttgatgga
acctccaacaactggggctggtgcaaacaaaagcttggagcaaatgctattcttgctgtt
tcacttgctgtgtgcaaagcaggagccatggtgaagaagattcccctttaccagcacatt
gcaaatcttgctggaaacaagactctcgtgctgcctgtacccgctttcaatgtgatcaat
ggaggatcccatgctggaaacaaacttgccatgcaggagttcatgatcctccctactggt
gcatcctctttcaaggaggccatgaagatgggagttgaggtgtaccaccacttgaagagt
ataatcaagaaaaagtatggccaagatgccacaaatgtgggggatgaaggtggctttgct
cctaacattcaggaaaacaaagagggcctcgaactgttgaaggccgcaatagctaaggct
ggctacacaggcaaagtggtcataggaatggatgttgcagcttctgaattttacagtgaa
aaggacaagacttacgatcttaacttcaaggaggataacaacgacggttcacacaaaatt
tcaggtgacagcctgaaagatgtgtacaagtcctttgtttctgagtaccctattgtgtcg
atcgaagatccattcgatcaggatgactgggctacctatgccaagcttactgatgagatt
ggacagcaagtgcagattgttggggatgaccttcttgttactaatcccacaagggttgcc
aaggcaattagtgaaaagacttgcaatgctcttctcttgaaggtgaatcaaataggctca
gttactgagagcattgaggctgttagaatgtccaagcgtgctggatggggagtgatggca
agccataggagtggtgagacagaggataccttcattgctgacctctcagttggtctgtct
acgggtcaaattaagacaggagctccctgtcggtcagagcgtctggctaaatacaaccag
ctgctcaggatagaagaagagctgggcgatgctgcagtttacgctggagaaaaattcaga
gcccctgtggagccgtactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346906
Entry
4346906           CDS       T01015                                 
Name
(RefSeq) enolase 1, chloroplastic
  KO
K01689  enolase 1/2/3 [EC:4.2.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
osa04820  Cytoskeleton in muscle cells
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4346906
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4346906
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    4346906
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4346906
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4346906
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     4346906
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4346906
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4346906
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 4346906
NCBI-ProteinID: XP_015612055
UniProt: B7FA07
LinkDB
Position
9:complement(join(16898341..16898406,16898553..16898603,16898698..16898844,16899152..16899469,16899565..16899719,16900056..16900363,16901759..16902153))
AA seq 479 aa
MAHRLLLPTNPLLPPGTGTATPRRRPVAATVRAALATSAEEARAATGAEVVRSIRARQIV
DSRGNPTVEVDLVAGDGRLHRSAVPSGASTGIYEALELRDGDGAAYGGKGVLNAVRNINE
VIAPKLVGVDVRNQSDVDAIMLDIDGTPNKSKLGANAILGVSLSVCRAGAGAKEVPLYKH
IQELAGTKELVMPVPAFNVINGGSHAGNNLAMQEFMLLPVGASSFSEALRMGSEVYHALK
GIIKAKYGQDACNVGDEGGFAPNVQDNREGLVLLMDAIEKAGYSGKIKIGMDVAASEFLT
KDGSYDLNFKNQPNDGAHVLSAQRLCDLYKEFVKDFPIVSIEDPFDQDDWSSWASLQSSV
NIQIVGDDLLVTNPKRIAEAIGKKACNALLLKVNQIGTVTESIQAALDSKAAGWGVMVSH
RSGETEDNFIADLAVGLASGQIKTGAPCRSERLAKYNQLLRIEMELGNVRYAGEAFRSP
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcccaccgcctcctcctccccaccaaccccctcctgccccccggcaccggcaccgcc
accccgcggcggcgccccgtcgccgccaccgtccgcgcggcgctcgcgacgtcggcggag
gaggcgagggcggcgacgggggcggaggtggtgcggtcgatccgggcgaggcagatcgtg
gacagccgcgggaaccccaccgtggaggtcgacctcgtcgccggggacgggcggctgcac
cgctccgcggtgcccagcggcgcatccacggggatctacgaggcgctcgagctccgcgac
ggggacggggcggcgtacggcgggaagggcgtgctcaacgccgtccgcaacatcaacgag
gtcatcgcgcccaagctcgtcggcgtcgacgtcaggaaccagagtgatgttgatgcaatc
atgctagacattgatggaactccgaacaagtcaaaattgggtgccaatgctattcttgga
gtctctttaagcgtatgcagggctggtgctggtgcaaaggaagttcctttatataaacat
attcaggagttggctggaacaaaggagcttgtcatgcccgtcccagctttcaatgtaata
aatggaggtagccatgcgggcaacaatctggccatgcaggagttcatgcttttacctgtg
ggagcatcttcattttctgaggctcttcgcatgggtagtgaagtttaccatgccctaaag
ggcatcattaaggcgaaatatggtcaagatgcatgcaatgttggagatgaaggtggcttt
gctcctaatgttcaagacaacagagaaggccttgtcttgcttatggatgccattgagaag
gcaggctactctggaaagattaaaattggaatggatgttgcagcatcagagtttcttaca
aaggatggaagctatgacttaaactttaagaatcagcctaatgatggagctcatgttctt
tcagcccagcgtctctgtgatctgtacaaagaatttgtcaaggatttccccattgtatca
attgaggaccctttcgatcaagatgactggagctcatgggcatcattgcagtcttcagtt
aatatccaaattgtgggggatgatttactcgtcacgaacccaaaacgtattgcagaggct
attggcaagaaggcttgcaatgctcttttgctgaaggttaatcaaattggcactgtcact
gaatcaattcaagctgctcttgattcaaaagctgctggttggggcgtgatggtcagccac
aggagtggggaaacggaagataatttcatcgcagatctggctgttggtttagcaagtggt
cagatcaaaactggtgctccatgccgtagcgagagactggcaaagtacaatcagcttctg
cggatcgaaatggagctaggcaatgtgcgctatgctggggaggcattcaggtctccctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348176
Entry
4348176           CDS       T01015                                 
Symbol
AD709, eno1, OSE1
Name
(RefSeq) enolase
  KO
K01689  enolase 1/2/3 [EC:4.2.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
osa04820  Cytoskeleton in muscle cells
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4348176 (AD709)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4348176 (AD709)
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    4348176 (AD709)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4348176 (AD709)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4348176 (AD709)
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     4348176 (AD709)
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4348176 (AD709)
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4348176 (AD709)
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 4348176
NCBI-ProteinID: NP_001390872
UniProt: Q42971
LinkDB
Position
10:complement(join(4779422..4779502,4779800..4779856,4779968..4780019,4780110..4780198,4780279..4780329,4780413..4780607,4780724..4780804,4780904..4780966,4781194..4781268,4781344..4781424,4781501..4781602,4781691..4781771,4781870..4781956,4782036..4782083,4782637..4782701,4782823..4782886,4783542..4783712))
AA seq 480 aa
MSRIHRNPTLLAPTPSPSSIPPLLEPSRSSPPPPMAATIVSVKARQIFDSRGNPTVEVDV
CCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGKGVSKAVDNVNSVIAPALIGKDPTS
QAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSLAICKAGAIIKKIPLYQHIANLAGN
KQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAASFKEAMKMGVEVYHNLKSVIKKKY
GQDATNVGDEGGFAPNIQENKEGLELLKTAIEKAGYTGKVVIGMDVAASEFYNDKDKTYD
LNFKEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQI
VGDDLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGE
TEDTFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgtctcgcatccatcgaaaccccactttattagcaccaaccccgtctccttcctccatt
cctccgctgctagaaccttctagaagctctcctcctcctcccatggcggcgacgatcgtg
tccgtcaaggcgcgccagatcttcgacagcaggggcaaccccaccgtcgaggtcgatgtg
tgctgctcagatggaacctttgcaagggctgcagttcccagtggtgcatcaactggtgtc
tatgaagctctcgaattgagggacggtggatctgattacttgggaaagggtgtttccaag
gctgtcgacaatgtgaactcggttattgccccagctctgattggcaaggaccctacgtca
caggctgagcttgataacttcatggttcagcagcttgatggaaccaaaaatgagtggggg
tggtgcaagcagaagcttggtgctaatgcaatcctggctgtgtcactggccatttgcaaa
gctggagctatcatcaagaagattcctctgtaccagcacattgccaaccttgctggaaac
aagcaactggttttgcccgtacctgcattcaacgtcattaacggtggatcacatgctgga
aacaagcttgccatgcaggagttcatgatccttcctactggggccgcttcattcaaggag
gccatgaagatgggtgttgaagtgtaccacaacctgaagtctgttatcaagaagaagtat
ggtcaggatgccaccaatgttggtgatgaaggtggttttgctcctaacattcaggaaaac
aaggagggtcttgagctcttgaagactgcaattgaaaaggctggatacactggcaaggtt
gtcattggaatggatgttgctgcttcggaattctacaatgacaaggacaaaacctatgac
cttaacttcaaggaggagaacaatgatggttcacaaaagatatctggtgatagcctgaag
aatgtatacaagtcatttgtcagtgaataccccattgtctcgattgaggatccgtttgac
caggatgactgggaacactatgctaagatgaccgctgaaattggagagcaagtgcagatt
gtcggtgatgacctccttgtcaccaacccaacaagggtggcaaaggcaatccaggagaag
tcatgcaatgctcttctgctgaaggttaaccaaattggatctgtcactgagagtattgag
gccgtgaagatgtcaaagcgtgctggctggggtgtgatgaccagccacaggagtggtgag
actgaggataccttcattgctgatttggctgttggtttggccacgggtcagatcaagact
ggagcaccctgccgatcagagcgccttgccaaatacaaccagcttcttaggattgaggag
gagcttggtgcggctgctgtctacgctggtgccaagttccgcgcacccgtggagccctac
taa

DBGET integrated database retrieval system