KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332286
Entry
4332286           CDS       T01015                                 
Name
(RefSeq) chorismate synthase 2, chloroplastic
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4332286
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     4332286
SSDB
Motif
Pfam: Chorismate_synt
Other DBs
NCBI-GeneID: 4332286
NCBI-ProteinID: XP_015633078
UniProt: Q10NY1 A0A8J8YH63
LinkDB
Position
3:complement(8177753..8181743)
AA seq 438 aa
MAAPTSSQPVARVLPRGGGGGFRAFPESAPASLRFSVGRRRAARLEVKASANVFGNYFQV
ATYGESHGGGVGCVISGCPPRIPLTEADMQVELDRRRPGQSRITTPRKETDTCKILSGTH
EGMTTGTPIHVFVPNTDQRGGDYSEMAKAYRPSHADATYDFKYGVRAVQGGGRSSARETI
GRVAAGALAKKILKLKSGVEILAFVSKVHQVVLPEDAVDYDTVTMEQIESNIVRCPDPEY
AQKMIDAIDKVRVRGDSIGGVVTCIARNVPRGIGSPVFDKLEAELAKAMLSLPASKGFEI
GSGFAGTDYTGSEHNDEFYMDEAGNVRTRTNRSGGVQGGISNGEIIYFKVAFKPTATIGK
KQHTVSREHEDVELLARGRHDPCVVPRAVPMVESMAALVLMDQLMAHIAQCEMFPLNLAL
QEPVGSASSVPAFAPDLS
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggccgcgccaacgtcgtcgcagccggtggcgcgcgtcctcccccgcggcggcggcggc
gggttccgcgccttcccggagtccgccccggcttccctccgcttctccgtcggccgccgc
cgcgccgctcgcctagaggtgaaggcgtctgcaaatgtatttgggaactacttccaggtt
gcaacttatggagagtctcatggaggcggtgttggttgcgtaatcagtggatgcccaccc
agaatcccacttactgaagcagatatgcaagtagaactcgaccggagacggccaggccag
agcagaataaccaccccaagaaaggagactgacacttgcaaaattctttcagggacacat
gaaggaatgaccactgggacaccaattcatgtttttgtcccgaacacagatcagagaggg
ggtgattacagtgaaatggctaaggcctacagaccttcacatgcagatgcaacttatgac
ttcaaatacggtgttagagcagtgcagggaggtggaagatcatcagcaagagagaccatt
ggaagggtggctgcaggagctcttgcaaagaaaattcttaagctcaaatctggagtagag
atcttggcgtttgtgtccaaggtgcatcaagttgtactaccagaagatgccgttgattat
gacactgtaacaatggaacagatagaaagcaacattgttagatgtcctgatccagaatat
gcacagaagatgattgatgcaatcgataaagtacgagttagaggtgattcgattggtggt
gtggtcacatgcattgcaagaaatgttcctcgtgggattggctctcctgtatttgacaaa
cttgaggctgaattggcgaaagctatgctttctcttcctgcaagcaaggggtttgagatc
ggcagtggatttgcaggtactgactacactggaagtgagcataatgatgagttctatatg
gatgaggctggaaatgtgagaacaagaactaatcgttcaggcggtgtgcagggagggata
tcaaatggtgaaattatatacttcaaagtagctttcaagccaaccgcgactattgggaag
aaacaacatactgtttcaagggagcatgaggatgttgaacttttagcaaggggccgccac
gacccatgtgttgtccctcgcgctgtgccgatggtggagtccatggccgcattagtcctc
atggaccagctgatggcgcacattgctcaatgtgagatgtttccactgaaccttgctcta
caagaaccagttggctctgccagcagcgtacctgcatttgcaccagatctatcataa

DBGET integrated database retrieval system