KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332364
Entry
4332364           CDS       T01015                                 
Name
(RefSeq) fructose-1,6-bisphosphatase, chloroplastic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4332364
   00030 Pentose phosphate pathway
    4332364
   00051 Fructose and mannose metabolism
    4332364
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4332364
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332364
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     4332364
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4332364
SSDB
Motif
Pfam: FBPase FBPase_C tRNA_NucTransf2
Other DBs
NCBI-GeneID: 4332364
NCBI-ProteinID: XP_015632363
UniProt: O64422
LinkDB
Position
3:complement(8841304..8843064)
AA seq 406 aa
MAAAATTSSHLLLLSRQQAAASLQCGLSFRRQPGRLAGGSSAPSVRCMAAVDTASAPAAT
EASKKSSYEITTLTTWLLKQEQAGTIDGEMTIVLASISTACKQIASLVQRAPISNLTGVQ
GAVNVQGEDQKKLDVVSNEVFSNCLKSSGRTGVIASEEEDVPVAVEESYSGNYIVVFDPL
DGSSNIDAAVSTGSIFGIYSPNDECLADIADDQNLDQVEQRCIVSVCQPGSNLLAAGYCM
YSSSVIFVLTIGTGVYVFTLDPMYGEFVLTQEKVQIPKAGKIYAFNEGNYALWDDKLKSY
MDSLKEPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDQKSKNGKLRLLYECAPMSF
IVEQAGGKGSDGHQRILDIMPTEIHQRVPLYIGSVEEVEKVEKFLA
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggccgccgcagccacgacatcctcccacctgctcctgctctcccgccagcaggcggcg
gcctcgctccaatgcggcctctccttccggaggcagcccggcaggctcgccggtgggtcg
tcggccccgagcgtgcggtgcatggcggccgtcgacacggcctcggcgcccgccgcgacg
gaggctagcaagaagagcagctacgagatcaccacgctgacgacgtggctgctgaagcag
gagcaggccgggaccatcgacggcgagatgaccatcgtgctggccagcatctccacggcg
tgcaagcagatcgcctcgctggtgcagcgcgcgcccatctccaacctcaccggcgtccag
ggcgccgtcaacgtgcagggcgaggaccagaaaaaactcgacgtcgtctccaacgaggtg
ttctccaactgcctcaaatcgagcgggcgcaccggcgtgatcgcgtcggaggaggaggac
gtgccggtggccgtggaggagagctactcgggcaactacatcgtggtgttcgacccgctc
gacggctcctccaacatcgacgccgccgtctccaccggctccatcttcggcatctacagc
cccaacgacgagtgcctagccgacatcgccgacgaccaaaatcttgaccaggtggagcag
aggtgcatcgtgagcgtgtgccagccggggagcaacctgctcgccgccggctactgcatg
tactcgagctcggtcatcttcgtgctcaccatcgggacaggggtgtacgtgttcacgctg
gacccgatgtacggcgagttcgtgctgacgcaggagaaggtgcagatccccaaggcaggc
aagatctatgccttcaacgagggcaactacgcgctctgggacgacaagctcaagagctac
atggacagcctcaaggagcccgggccgtccgggaagccatactccgcgcgctacatcggc
agcctcgtcggcgacttccaccgcacgctgctctacggcggcatctacggctaccccagg
gaccagaagagcaagaacggcaagctgcggctgctgtacgagtgcgcgccgatgagcttc
atcgtcgagcaggccggcggcaagggctccgatggccaccagaggatacttgacatcatg
cctacggagatccatcagagagtgccgctgtacatcgggagcgtggaggaagtggagaag
gtcgagaagttcttggcttga

DBGET integrated database retrieval system