KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332425
Entry
4332425           CDS       T01015                                 
Name
(RefSeq) trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 isoform X1
  KO
K12450  UDP-glucose 4,6-dehydratase [EC:4.2.1.76]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4332425
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.76  UDP-glucose 4,6-dehydratase
     4332425
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 NAD_binding_10
Other DBs
NCBI-GeneID: 4332425
NCBI-ProteinID: XP_015630773
LinkDB
Position
3:9445278..9448703
AA seq 679 aa
MQAKMAAYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLSNLNPSRPS
PNFKFVKGDIASADLVNYLLTTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE
ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRS
YGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFE
VVLHKGEVGHVYNIGTVKERRVIDVAKDICKLFGLDTEKVIRFVENRPFNDQRYFLDDQK
LKKLGWAERTLWEEGLKKTIEWYTNNPDYWGDVAGALLPHPRMLMTPGVERHNWTDEIKS
LSTSPDEAKESSTAVPAATAKSTSSAPQKASYKFLIYGRTGWIGGLLGKICEKQGIPYEY
GKGRLEERSQLLQDIRNVKPTHVFNAAGVTGRPNVDWCETHKQDTIRTNVVGTLNLADVC
REQGLLMINYATGCIFEYDAKHPEGSGIGFKEEDKPNFTGSYYSKTKAMVEELLQEYDNV
CTLRVRMPISSDLSNPRNFITKIARYDKVVNIPNSMTILDELLPISIEMAKRDCRGIWNF
TNPGVVSHNEILEMYKKYLNPDFKWTNFTLEEQAKVIVAPRSNNEMDASKLKSEFPELLS
IKDSLVKYVFEPNRKVPAN
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgcaggcgaagatggcggcttacgagcccaagaacattcttataaccggcgctgctggt
ttcatcgcatcacatgtggcgaaccgcctagtcaggaactatccgcactacaagattgtt
gtcctcgacaagctcgattactgttccagcctgagcaatctcaacccttcacgtccatcg
ccgaatttcaagtttgtcaagggtgacattgcaagtgctgatctggtgaactaccttctc
acaactgagtcaattgacactatcatgcactttgctgctcagactcatgtggataattca
tttggcaattcctttgagtttacaaagaacaatatttatggtacccatgtccttcttgag
gcctgcaaggttactggtcagattagaagatttattcatgtgagtactgacgaggtgtac
ggagaaactgatgaggatgctgtggttggcaaccatgaggcctcacagctgcttccaaca
aacccatattcagctacaaaagctggggctgagatgcttgtgatggcttatggaagatct
tatggccttcctgtgattacaactcggggcaacaatgtatatgggccaaatcagttccct
gagaagctcattcccaaatttattcttttggcaatgagaggcttgccccttcccattcac
ggtgatggctcaaatgtcagaagctatctgtattgtgaggatgttgctgaagcttttgag
gtggttcttcacaaaggagaggttgggcatgtgtacaatattggtactgtgaaggaaagg
agggtgattgatgtggccaaggacatatgcaagctctttggcttggacaccgagaaggtc
atcagatttgttgagaacaggcctttcaacgaccagagatacttcttggatgatcagaag
ctgaagaaattgggatgggcagagcgcacactatgggaagaggggttgaagaaaacaatt
gaatggtacactaacaatcctgattactggggagatgtcgcaggtgccttgctccctcat
ccaaggatgttgatgacacctggagttgaaaggcataactggactgatgagatcaaatct
ctttccacttcaccagatgaagctaaggaatctagcactgcggttcctgcagccactgcc
aaaagcaccagcagtgcccctcaaaaggcctcatacaagttcttgatatatggtaggact
ggatggattggtggtctacttggtaagatatgtgagaagcaagggattccatatgagtat
gggaaaggacgcctggaagagcgctctcagctcttgcaggacattagaaatgtgaagcca
actcatgttttcaatgctgctggtgtcactgggaggccaaatgttgactggtgcgagacc
cataaacaggatactatccgcaccaatgttgttggcaccttgaaccttgctgatgtttgt
cgtgagcagggcttgctcatgattaattatgctacaggttgcatatttgagtatgatgct
aagcaccccgaaggatcaggaattggttttaaagaggaagataagcccaactttactggt
tcatattattccaaaactaaagctatggttgaagagctgttgcaagaatatgacaacgtc
tgtacgcttcgagtcaggatgcccatatcatcagatttgagcaacccccgtaacttcatc
acaaagatagctcgttatgacaaggtggtaaacatccccaacagtatgacaattttggat
gagcttttgcccatctccattgagatggcgaagcgggactgcaggggcatatggaacttc
accaatcctggggttgtcagccacaacgagatcctggagatgtacaagaaatacctcaac
cccgacttcaagtggaccaacttcactcttgaggaacaggccaaggttatagttgcacca
agaagtaacaacgaaatggatgcatcgaagttgaagtccgagttccccgagctactgtcc
atcaaggattctttggttaagtatgtttttgagccaaacaggaaggttcctgctaactga

DBGET integrated database retrieval system