KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332475
Entry
4332475           CDS       T01015                                 
Name
(RefSeq) mitogen-activated protein kinase 5 isoform X2
  KO
K20536  mitogen-activated protein kinase 3 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4332475
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4332475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4332475
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     4332475
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   4332475
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like Haspin_kinase FTA2 APH
Other DBs
NCBI-GeneID: 4332475
NCBI-ProteinID: XP_015630496
UniProt: Q10N20
LinkDB
Position
3:complement(9847712..9850468)
AA seq 369 aa
MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKYQPPIMPIGRGAYGIVCSVMNFETRE
MVAIKKIANAFNNDMDAKRTLREIKLLRHLDHENIIGIRDVIPPPIPQAFNDVYIATELM
DTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICD
FGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPLFPGR
DHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAALDLIE
RMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLIFNEA
IEMNPNIRY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggacggggcgccggtggcggagttcaggccgacgatgacgcacggcggccggtacctg
ctctacgacatcttcgggaacaagttcgaggtgacgaacaagtaccagccgcccatcatg
cccattggccgcggcgcctacgggatcgtctgctccgtgatgaactttgagacgagggag
atggtggcgataaagaagatcgccaacgcgttcaacaacgacatggacgccaagcgcacg
ctccgggagatcaagctcctcaggcacctcgaccacgagaacatcataggcatcagggat
gtgatcccgccgccgatccctcaggcgttcaacgacgtctacatcgccacggagctcatg
gacaccgacctccatcacatcatccgctccaaccaagaactgtcagaagagcactgccag
tatttcctgtaccagatcctgcgggggctcaagtacatccactcggcgaacgtgatccac
cgcgacctgaagccgagcaacctgctgctgaacgccaactgcgacctcaagatctgcgac
ttcgggctggcgcggccgtcgtcggagagcgacatgatgacggagtacgtggtcacccgg
tggtaccgcgcgccggagctgctgctcaactccaccgactactccgccgccatcgacgtc
tggtccgtcggctgcatcttcatggagctcatcaaccgccagccgctcttccccggcagg
gaccacatgcaccagatgcgcctcatcaccgaggtgatcgggacgccgacggacgacgag
ctggggttcatacggaacgaggacgcgaggaagtacatgaggcacctgccgcagtacccg
cgccggacgttcgcgagcatgttcccgcgggtgcagcccgccgcgctcgacctcatcgag
aggatgctcaccttcaacccgctgcagagaatcacagttgaggaggcgctcgatcatcct
tacctagagagattgcacgacatcgccgatgagcccatctgcctggagcccttctccttc
gacttcgagcagaaggctctaaacgaggaccaaatgaagcagctgatcttcaacgaagcg
atcgagatgaacccaaacatccggtactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340170
Entry
4340170           CDS       T01015                                 
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K14512  mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04075  Plant hormone signal transduction
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4340170
   04075 Plant hormone signal transduction
    4340170
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4340170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4340170
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     4340170
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   4340170
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like Haspin_kinase Tom22
Other DBs
NCBI-GeneID: 4340170
NCBI-ProteinID: XP_015643193
UniProt: Q84UI5 A0A510BUC5
LinkDB
Position
6:complement(2806556..2812996)
AA seq 398 aa
MDAGAQPPDTEMAEAGGGQQPPAAAAAAGAGAGAGMMENIQATLSHGGRFIQYNIFGNVF
EVTAKYKPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRH
MDHENIVAIRDIIPPPQRNSFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRG
LKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLL
NSSEYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPNEADLDFVNENAR
RYIRQLPRHARQSFPEKFPHVHPLAIDLVEKMLTFDPRQRITVEGALAHPYLASLHDISD
EPVCSSPFSFDFEQHALSEEQMKDLIYQEGLAFNPDYQ
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggacgccggggcgcagccgccggacacggagatggcggaggccggcggcgggcagcag
ccgcctgctgcggctgcggcggcgggggcgggggcaggggcggggatgatggagaacatc
caggcgacgctgagccatggcgggaggttcatccagtacaacatcttcgggaacgtgttc
gaggtcaccgccaagtacaagccccccatcctccccatcggcaagggcgcctacggcatc
gtctgctcggcgctcaactcggagacgggggagcaggtggcgatcaagaagatcgccaac
gcgttcgacaacaagatcgacgccaagcgcacgctcagggagatcaagctgctccgccac
atggaccacgagaatattgttgccataagggatatcatacctcctccacaaaggaattca
ttcaatgacgtttatattgcatatgaattgatggatactgatctgcatcaaattattcgc
tcaaatcaagcattgtcagaggagcactgccagtatttcctttatcagattctccgtggc
ttgaagtatatacattcagcaaatgtccttcaccgagacttgaagcccagcaacctactt
ttgaatgcaaattgtgacctcaaaatttgtgattttggacttgctcgtaccacctcagaa
accgattttatgactgagtatgttgtcacaagatggtatagggcaccggaacttctgttg
aattcctctgaatatactgcagcaattgatgtgtggtctgtgggctgtatttttatggaa
ctcatggatcgtaaacctttgtttcctggaagagatcatgtccatcaattacgtctacta
atggagctcatcggaacgccaaatgaggctgatctggattttgtaaatgaaaatgcaaga
agatacattcgccaacttcctagacatgcaaggcagtcctttcctgaaaaatttccacat
gttcatcctttagcaattgatctggttgaaaagatgctgacatttgatcctagacagaga
ataacagttgaaggtgcccttgcacatccttacctggcatcactgcatgacataagtgat
gagccagtctgctcatcacccttcagctttgacttcgagcagcatgcattgtccgaggaa
caaatgaaggatctaatctaccaagaaggccttgcgttcaaccctgattaccagtag

DBGET integrated database retrieval system