KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332492
Entry
4332492           CDS       T01015                                 
Name
(RefSeq) lipid phosphate phosphatase gamma, chloroplastic
  KO
K07252  dolichyldiphosphatase [EC:3.6.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4332492
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.43  dolichyldiphosphatase
     4332492
SSDB
Motif
Pfam: PAP2 PAP2_3 DUF2070
Other DBs
NCBI-GeneID: 4332492
NCBI-ProteinID: XP_015631155
UniProt: A3AGV0 Q10MZ3
LinkDB
Position
3:complement(9990531..9993310)
AA seq 224 aa
MAEFQEMAAEVPPSLKAITLTHVRYRRGDTLGLFLAWVSLVPVFISLGGFVSHFLFRREL
QGICFAAGLLASQLLNELIKHSVAQSRPVYCELLEACDSHGWPSSHSQYTFFFATYLSLL
TLRRSPSSRVVASLAWPLAFLTMLSRVYLGYHTVAQVFAGAVVGLVFGAIWYWIVNTMLV
EYFPMIEESAIARWLYMKDTSHIPDVLKFEYDNARAARRKVATD
NT seq 675 nt   +upstreamnt  +downstreamnt
atggcggagttccaggagatggcggcggaggtgccgccgtcgctgaaggcgatcacgctg
acccacgtccggtaccgccgcggggacacgctcggcctcttcctcgcctgggtctccctc
gtcccggtcttcatcagcctgggcgggttcgtctcccacttcctcttccgccgggagctc
cagggcatctgcttcgccgcgggcctcctcgcctcccagctcctcaacgagctcatcaag
cactccgtcgcgcagtcgcgcccggtctactgcgagctgctcgaggcctgcgactcccac
ggctggccctccagccactcgcagtacaccttcttcttcgccacctacctctcgctcctc
acgctccgccgctccccgtcgagccgggtggtcgcctccctggcctggccgctcgccttc
ctcaccatgctgtccagggtgtacctcggctaccacaccgtcgcgcaggtatttgccggc
gcggtagtaggccttgtgtttggtgcaatctggtattggattgtcaacaccatgcttgtt
gaatattttccaatgattgaggagagtgcaatagcgaggtggttgtatatgaaggatact
tcacacattccagatgtgctcaagtttgaatatgataacgcaagggctgccaggaggaaa
gttgctactgattga

DBGET integrated database retrieval system