KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332531
Entry
4332531           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases I and III subunit rpac1
  KO
K03027  DNA-directed RNA polymerases I and III subunit RPAC1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4332531
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4332531
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     4332531
  RNA polymerase I system
   RNA polymerase I
     4332531
SSDB
Motif
Pfam: RNA_pol_L RNA_pol_A_bac Fer4_7
Other DBs
NCBI-GeneID: 4332531
NCBI-ProteinID: XP_015631447
UniProt: Q10MU2 B9F7T9
LinkDB
Position
3:complement(10320248..10324850)
AA seq 379 aa
MPKKGTKSRKGTDDEPKQEEKNKLPEHLEVQRTRVVCKGDAPVNTEGFQYAGAFAAMGID
NSVSADKFCKNFKVVVNRLTEDDMEFDMIGIDASMANAFRRILIAEVPTMAIEKVLMADN
TSVIADEVLSHRLGLIPLDADPRLFEYISENDVPTERNTIVYKLHVSCKKGSPRLTVKSG
DLEWLPEGSQLPLASPAQSGDKQKTYTSFSQSQKDILEKPLGVKFKDITIARLGPGQAIE
LEVHAVKGIGKVHAKWSPVATAWYRMLPEVVLREEIKDADAEMLVAKCPVNVFDIEDLGN
GEKRAVVARPRACTLCRQCVMGPTGEVMGPTVEQVELRRVRDHFIFTIESTGALPPEMLF
TEAVRILEEKCERVISELS
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgccgaagaaggggacgaaatcgaggaagggcacggacgatgagcccaagcaggaggag
aagaacaagcttccggagcaccttgaggtccagcggacgcgtgtggtctgcaagggcgac
gcccccgtaaatactgaaggttttcaatacgctggtgcttttgctgctatgggaatcgat
aacagtgtctcagcggataagttttgcaaaaactttaaagtcgtggtaaatcgacttacg
gaagatgatatggagtttgatatgattggtattgatgcatcaatggctaatgcttttcgg
agaatccttatagcagaggttcctacaatggcaattgagaaagttttaatggctgacaat
acctcagttatagcagatgaagttctttcacatagacttggccttattccacttgatgca
gatcctaggctttttgaatatatctcagaaaatgatgtcccaactgaaagaaacactatt
gtgtacaaactccatgtttcatgtaaaaagggttccccacggcttacagtgaagtctggt
gatttagagtggctgccagaaggtagccaactacctttggcatctcctgctcaatctggg
gacaaacaaaagacgtacacttccttcagccaaagccagaaggatatcttagaaaagcct
cttggtgtgaaatttaaagacataactattgcgaggcttgggccaggccaggctattgaa
cttgaggtacatgctgttaagggaataggaaaagtgcatgccaagtggtccccagttgct
acagcttggtatagaatgctccctgaggttgttcttcgtgaagaaatcaaagatgctgat
gcagagatgctagtggcaaagtgcccagtcaatgtttttgacatcgaagacctgggaaac
ggggaaaagagagcggttgttgctaggccaagagcatgcaccctttgtaggcaatgcgtt
atgggacctactggggaagttatgggacctactgtggaacaagtagaactacggcgtgtc
agagaccacttcatctttacgattgagtctactggagctctaccgccggagatgctgttc
acagaggctgtgaggatcctcgaggagaagtgcgagagagtgatatctgaactgtcatga

DBGET integrated database retrieval system