KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332596
Entry
4332596           CDS       T01015                                 
Name
(RefSeq) argininosuccinate lyase, chloroplastic
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4332596
   00220 Arginine biosynthesis
    4332596
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332596
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     4332596
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4332596
SSDB
Motif
Pfam: Lyase_1 ASL_C2
Other DBs
NCBI-GeneID: 4332596
NCBI-ProteinID: XP_015632553
UniProt: A0A8J8YR24 Q10MK5
LinkDB
Position
3:10843220..10847661
AA seq 519 aa
MAAATSQSFLSPAPNPLLRPRILPFPAGGSVSLRGRRPAFPSVAAASTSMASSESEERKE
TKLWGGRFEEGVTDAVEGFTESISYDWQLYKYDIMGSKAHASMLAAQGLITAGDKDIILE
GLDQIEKLIQDGKFEWRTDREDVHMNIEAALIEKVGEPAKKLHTARSRNDQIVTDLRLWC
RDAIDKILFRIKQFQVSLVLLASKYVDLIVPGYTHLQRAQPVLLPHLLLSYVEQLERDAG
RLVNCRERLNFCPLGACALAGTGLPIDRFKTAKDLKFTAPMKNSIDAVSDRDFVLEFLAA
NSIAAVHLSRIGEEWVLWASEEFGFLTPSDSVSTGSSIMPQKKNPDPMELVRGKSARVFG
DLMTVLTLCKGLPQAYNRDLQEDKEPLFDSVKAVLGMLEVCTEFAQNISFNSKRIQSSLP
AGYLDATTLADYLVKKGVPFRTSHEIVGRSVALCVSKNCQLAELGLDDLKSVHPVFEGDV
YEYLGVENAVNKFISYGSTGSEQVKKQLEDWRTQLGISS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggccgccgccacctcccaatccttcctctcgccggcgcccaacccccttctccgcccg
aggatcctccccttccccgccggcgggtccgtgtccctccgcggccgccgccccgccttc
ccgtccgtcgccgcggcgtccacatcgatggcgtcctcggagagcgaggagaggaaggag
accaagctgtggggcgggcgattcgaggagggcgtcaccgacgccgtggaagggttcacc
gagtccatctcctacgactggcagctctacaagtacgacatcatgggcagcaaggcccac
gcatccatgctcgccgcgcagggtttgataacggctggcgataaggacatcatcttagag
gggcttgatcaaatagagaagctgattcaggatggaaaatttgagtggcggacagaccgg
gaggatgtccatatgaatattgaggcagctctgatcgaaaaggttggtgaaccagccaag
aaactgcatactgctaggagccgcaatgaccaaatcgtgacggatctccgcctgtggtgc
cgtgatgctattgacaagattttgttccgcatcaaacagtttcaggtgtctcttgttctg
ttagcttcaaaatatgttgacttaatagttcctggttacactcacctgcaaagggcacag
cctgttttgcttccacatctcctcttatcatatgttgaacagttggagcgtgatgctgga
cggctggtcaactgcagggaacggttgaatttctgtcctcttggtgcttgtgctttggct
ggtactggacttcctatcgataggttcaaaactgctaaagatttgaagtttacagctcca
atgaagaacagtattgatgcagtatcagaccgcgactttgtattggaatttcttgctgcc
aattcaattgctgctgttcatctttcacgaattggtgaagagtgggtcttatgggcatca
gaggagtttggattcctcacaccaagtgactctgtttcaactggaagcagcattatgcca
cagaagaaaaatccagatccaatggagcttgttcgtggcaaatctgctcgtgtttttgga
gatctcatgactgtcctcaccctttgtaaaggacttccgcaggcctacaaccgtgattta
caggaagacaaggaacccttgtttgacagcgtgaaggctgtattaggaatgcttgaagta
tgtaccgagtttgctcaaaatatctccttcaactcaaaaagaatacaaagttcgctgcct
gctggctatttggatgcaacaacactagcagattatcttgtgaagaagggcgtgccgttc
agaacctcgcacgagatagttggaaggtctgtagctctatgcgtctcgaagaactgtcag
ctcgccgaacttggactagacgacctgaaatctgttcaccccgtttttgagggcgatgtg
tacgagtatctgggagtggagaacgccgtaaacaagttcatatcttacggctctacaggc
tcggagcaagtaaaaaaacagctcgaggattggcgcactcagcttggcattagttcataa

DBGET integrated database retrieval system