KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332623
Entry
4332623           CDS       T01015                                 
Name
(RefSeq) phytochrome B isoform X2
  KO
K12121  phytochrome B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4332623
SSDB
Motif
Pfam: PHY PAS PAS_2 GAF HATPase_c PAS_9 PAS_4 HisKA PAS_8 PAS_3
Other DBs
NCBI-GeneID: 4332623
NCBI-ProteinID: XP_015631282
UniProt: Q10MG9 I3RUD9
LinkDB
Position
3:11020017..11028186
AA seq 1171 aa
MASGSRATPTRSPSSARPAAPRHQHHHSQSSGGSTSRAGGGGGGGGGGGGGAAAAESVSK
AVAQYTLDARLHAVFEQSGASGRSFDYTQSLRASPTPSSEQQIAAYLSRIQRGGHIQPFG
CTLAVADDSSFRLLAYSENTADLLDLSPHHSVPSLDSSAVPPPVSLGADARLLFAPSSAV
LLERAFAAREISLLNPLWIHSRVSSKPFYAILHRIDVGVVIDLEPARTEDPALSIAGAVQ
SQKLAVRAISRLQALPGGDVKLLCDTVVEYVRELTGYDRVMVYRFHEDEHGEVVAESRRN
NLEPYIGLHYPATDIPQASRFLFRQNRVRMIADCHAAPVRVIQDPALTQPLCLVGSTLRS
PHGCHAQYMANMGSIASLVMAVIISSGGDDDHNISRGSIPSAMKLWGLVVCHHTSPRCIP
FPLRYACEFLMQAFGLQLNMELQLAHQLSEKHILRTQTLLCDMLLRDSPTGIVTQSPSIM
DLVKCDGAALYYHGKYYPLGVTPTEVQIKDIIEWLTMCHGDSTGLSTDSLADAGYPGAAA
LGDAVSGMAVAYITPSDYLFWFRSHTAKEIKWGGAKHHPEDKDDGQRMHPRSSFKAFLEV
VKSRSLPWENAEMDAIHSLQLILRDSFRDSAEGTSNSKAIVNGQVQLGELELRGIDELSS
VAREMVRLIETATVPIFAVDTDGCINGWNAKVAELTGLSVEEAMGKSLVNDLIFKESEET
VNKLLSRALRGDEDKNVEIKLKTFGPEQSKGPIFVIVNACSSRDYTKNIVGVCFVGQDVT
GQKVVMDKFINIQGDYKAIVHNPNPLIPPIFASDENTCCSEWNTAMEKLTGWSRGEVVGK
LLVGEVFGNCCRLKGPDALTKFMIVLHNAIGGQDCEKFPFSFFDKNGKYVQALLTANTRS
RMDGEAIGAFCFLQIASPELQQAFEIQRHHEKKCYARMKELAYIYQEIKNPLNGIRFTNS
LLEMTDLKDDQRQFLETSTACEKQMSKIVKDASLQSIEDGSLVLEKGEFSLGSVMNAVVS
QVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQVLCDFLLSMVRFAPAENGWVEIQVR
PNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMFSNSRWTTQEGIGLSICRKILKLMGG
EVQYIRESERSFFHIVLELPQPQQAASRGTS
NT seq 3516 nt   +upstreamnt  +downstreamnt
atggcctcgggtagccgcgccacgcccacgcgctccccctcctccgcgcggcccgcggcg
ccgcggcaccagcaccaccactcgcagtcctcgggcgggagcacgtcccgcgcgggaggg
ggtggcgggggcgggggagggggagggggcggcgcggccgccgcggagtcggtgtccaag
gccgtggcgcagtacaccctggacgcgcgcctccacgccgtgttcgagcagtcgggcgcg
tcgggccgcagcttcgactacacgcagtcgctgcgtgcgtcgcccaccccgtcctccgag
cagcagatcgccgcctacctctcccgcatccagcgcggcgggcacatacagcccttcggc
tgcacgctcgccgtcgccgacgactcctccttccgcctcctcgcctactccgagaacacc
gccgacctgctcgacctgtcgccccaccactccgtcccctcgctcgactcctccgcggtg
cctccccccgtctcgctcggcgcagacgcgcgcctccttttcgccccctcgtccgccgtc
ctcctcgagcgcgccttcgccgcgcgcgagatctcgctgctcaacccgctctggatccac
tccagggtctcctctaaacccttctacgccatcctccaccgcatcgatgtcggcgtcgtc
atcgacctcgagcccgcccgcaccgaggatcctgcactctccatcgctggcgcagtccag
tctcagaagctcgcggtccgtgccatctcccgcctccaggcgcttcccggcggtgacgtc
aagctcctttgcgacaccgttgttgagtatgttagagagctcacaggttatgaccgcgtt
atggtgtacaggttccatgaggatgagcatggagaagtcgttgccgagagccggcgcaat
aaccttgagccctacatcgggttgcattatcctgctacagatatcccacaggcatcacgc
ttcctgttccggcagaaccgtgtgcggatgattgctgattgccatgctgcgccggtgagg
gtcatccaggatcctgcactaacacagccgctgtgcttggttgggtccacgctgcgttcg
ccgcatggttgccatgcgcagtatatggcgaacatgggttccattgcatctcttgttatg
gcagtgatcattagtagtggtggggatgatgatcataacatttcacggggcagcatcccg
tcggcgatgaagttgtgggggttggtagtatgccaccacacatctccacggtgcatccct
ttcccactacggtatgcatgcgagttcctcatgcaagcctttgggttgcagctcaacatg
gagttgcagcttgcacaccaactgtcagagaaacacattctgcggacgcagacactgctg
tgtgatatgctactccgggattcaccaactggcattgtcacacaaagccccagcatcatg
gaccttgtgaagtgtgatggtgctgctctgtattaccatgggaagtactaccctcttggt
gtcactcccacagaagttcagattaaggacatcatcgagtggttgactatgtgccatgga
gactccacagggctcagcacagatagccttgctgatgcaggctaccctggtgctgctgca
ctaggagatgcagtgagtggaatggcggtagcatatatcacgccaagtgattatttgttt
tggttccggtcacacacagctaaggagataaagtggggtggtgcaaagcatcatccagag
gataaggatgatggacaacgaatgcatccacgatcatcgttcaaggcatttcttgaagtt
gtgaagagtaggagcttaccatgggagaatgcggagatggatgcaatacattccttgcag
ctcatattgcgggactctttcagagattctgcagagggcacaagtaactcaaaagccata
gtgaatggccaggttcagcttggggagctagaattacggggaatagatgagcttagctcg
gtagcaagggagatggttcggttgatcgagacagcaacagtacccatctttgcagtagat
actgatggatgtataaatggttggaatgcaaaggttgctgagctgacaggcctctctgtt
gaggaagcaatgggcaaatcattggtaaatgatctcatcttcaaggaatctgaggaaaca
gtaaacaagctactctcacgagctttaagaggtgatgaagacaaaaatgtagagataaag
ttgaagacattcgggccagaacaatctaaaggaccaatattcgttattgtgaatgcttgt
tctagcagggattacactaaaaatattgttggtgtttgttttgttggccaagatgtcaca
ggacaaaaggtggtcatggataaatttatcaacatacaaggggattacaaggctatcgta
cacaaccctaatcctctcatacccccaatatttgcttcagatgagaatacttgttgttcg
gagtggaacacagcaatggaaaaactcacaggatggtcaagaggggaagttgttggtaag
cttctggtcggtgaggtctttggtaattgttgtcgactcaagggcccagatgcattaacg
aaattcatgattgtcctacacaacgctataggaggacaggattgtgaaaagttccccttt
tcattttttgacaagaatgggaaatacgtgcaggccttattgactgcaaacacgaggagc
agaatggatggtgaggccataggagccttctgtttcttgcagattgcaagtcctgaatta
cagcaagcctttgagattcagagacaccatgaaaagaagtgttatgcaaggatgaaggaa
ttggcttacatttaccaggaaataaagaatcctctcaacggtatccgatttacaaactcg
ttattggagatgactgatctaaaggatgaccagaggcagtttcttgaaaccagcactgct
tgtgagaaacagatgtccaaaattgttaaggatgctagcctccaaagtattgaggatggc
tctttggtgcttgagaaaggtgaattttcactaggtagtgttatgaatgctgttgtcagc
caagtgatgatacagttgagagaaagagatttacaacttattcgagatatccctgatgaa
attaaagaagcctcagcatatggtgaccaatatagaattcaacaagttttatgtgacttt
ttgctaagcatggtgaggtttgctccagctgaaaatggctgggtggagatacaggtcaga
ccaaatataaaacaaaattctgatggaacagacacaatgcttttcctcttcaggtttgcc
tgtcctggcgaaggccttcccccagagattgttcaagacatgtttagtaactcccgctgg
acaacccaagagggtattggcctaagcatatgcaggaagatcctaaaattgatgggtggc
gaggtccaatatataagggagtcggagcggagtttcttccatatcgtacttgagctgccc
cagcctcagcaagcagcaagtagggggacaagctga

DBGET integrated database retrieval system