KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332628
Entry
4332628           CDS       T01015                                 
Name
(RefSeq) short-chain-enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00640  Propanoate metabolism
osa00650  Butanoate metabolism
osa00903  Limonene and pinene degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4332628
   00650 Butanoate metabolism
    4332628
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4332628
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4332628
   00310 Lysine degradation
    4332628
   00360 Phenylalanine metabolism
    4332628
   00380 Tryptophan metabolism
    4332628
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4332628
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4332628
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4332628
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 4332628
NCBI-ProteinID: XP_015632322
LinkDB
Position
3:11068947..11071086
AA seq 312 aa
MQYCSVKRSLPKKRDTSTRYSHPHSRRSSVYQTEKLVNPTPPDPMAATSPDSGDLILVEP
AKPGSRVAVVTINRPKALNALTRPMMVSLAAAFRRLDADDGVAAVVLAGRGRAFCSGVDL
TAAEEVFKGDVKDPAADPVVQMERCRKPIVGAIAGFAVTAGFEIALACDILVAGRSAKFI
DTHAKFGIFPSWGLSQKLSRVIGPNRAREVSLTCMPITAEMAEKWGLVNHIVDDTQVLSK
AIEVCEAIARNNRNLVVLYKSVINDGLQLDLEHARALEKERAHDYYNGMTKEQFASMQKF
IQGRSSKPPSKL
NT seq 939 nt   +upstreamnt  +downstreamnt
atgcagtattgcagtgtcaaaaggtctcttccaaaaaaaagagacacgagcacacgctac
tcccatccccactctcgtcgctcgtcggtataccaaaccgaaaagctagtcaatccgacc
ccacccgatccgatggccgccacatcgccggactccggcgacctcatcctggtcgagccg
gccaagccggggtcccgggtcgccgtcgtcaccatcaaccggcccaaagcgctgaacgcg
ctgacgcggcccatgatggtctcactggccgcggcgttccggcggctggacgccgacgac
ggggtggcggcggtggtgctcgcggggcgcggccgcgcgttctgctccggcgtggacctg
accgctgcggaggaggtgttcaagggcgacgtgaaggatcccgccgccgaccccgtcgtc
cagatggagcgctgtcgcaagcccatcgtcggcgccatcgccggattcgccgtcaccgcc
ggatttgagatcgccctcgcctgcgacatcctagtggccggccgctccgctaagttcatc
gacacccacgccaagtttgggatattcccttcttggggtctttcacagaagctttctcgt
gtcattggaccaaatagagcacgggaagtgtcgttaacttgcatgcctatcacagctgaa
atggcggagaagtggggtcttgttaaccacattgtggatgatacccaggtgctgagtaag
gcaatagaggtctgtgaggccattgcaaggaacaatcgcaacttggttgtgttgtataaa
tctgttataaatgacgggctccagctggacttggaacatgctcgagctcttgaaaaggaa
agagctcatgactattacaatggtatgacaaaagagcaattcgcaagtatgcagaaattt
atacagggccggagttcgaagccaccatcaaagctgtga

DBGET integrated database retrieval system