KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332645
Entry
4332645           CDS       T01015                                 
Name
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 isoform X1
  KO
K12820  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15/PRP43 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332645
   03009 Ribosome biogenesis [BR:osa03009]
    4332645
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4332645
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    4332645
 Complex B
    4332645
 Complex C
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-SnRNP related factors
    4332645
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  90S particles
   Helicases
    4332645
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_19 AAA_30 ResIII SRP54 ABC_tran T2SSE DUF2075 AAA_7 AAA_29
Other DBs
NCBI-GeneID: 4332645
NCBI-ProteinID: XP_015631016
UniProt: Q10MC7
LinkDB
Position
3:11237758..11241532
AA seq 722 aa
MGTERKRKVSLFDVVDETSVSAKLGRAATTNGSAAAAAANPSINRWTGRPYSARYLEILE
KRRTLPVWQQKDDFLAVLRDNQTLILVGETGSGKTTQIPQFVLEAEGLSNRSMVACTQPR
RVAAMSVSRRVAEEMDVTIGEEVGYSIRFEDCSSHKTVLKYLTDGMLLREAMADPLLERY
KVIVLDEAHERTLATDVLFGLLKEVLKNRPDLKLVVMSATLEAEKFQTYFSGAPLMKVPG
RLHPVEIFYTQEPERDYLEAAIRTVVQIHMCEPAGDILVFLTGEEEIEDACRKINKEINN
MGDQVGPVKVVPLYSTLPPAMQQKIFEPAPAPSREGGPAGRKIVVSTNIAETSLTIDGIV
YVIDPGFSKQKVYNPRIRVESLLVSPISKASAHQRAGRAGRTQPGKCFRLYTEKSFNDDL
QPQTYPEILRSNLANTVLTLKKLGIDDLVHFDFMDPPAPETLMRALEVLNYLGALDDDGN
LTPLGETMSEFPLDPQMSKMLVISPKYNCSNEILSISAMLSVPNCFLRPREAQKAADEAK
ARFGHIDGDHLTLLNVYHAYKQNNEDPQWCYENFINARALKSADNVRQQLVRIMTRFNLK
MCSTDFNSREYYVNIRKAMLAGYFMQVAHLERTGHYLTVKDNQVVHLHPSNCLDHKPEWV
IYNEYVLTTRNFIRTVMDIRGDWLIDVAPHYYDLSNFPSCEAKRVLERLYNKRERERAAN
RN
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggggacggagcggaagcgcaaggtgagcctcttcgacgtggtcgacgagacctccgtc
tccgccaagctcggccgcgccgccaccaccaacggctcggccgccgccgccgcggccaac
ccgtccatcaatcggtggacggggaggccctactcggcgaggtacctcgagatcctcgag
aagcgccgcacgctacccgtgtggcagcagaaggacgatttcctcgccgtcctccgcgac
aaccagaccctcatcctcgtcggagaaaccggaagcggcaagaccactcagattccccaa
ttcgtgctcgaggctgaaggcttgagcaaccgctcaatggttgcttgcacccagccgcgg
agggtggcagctatgtcagtttcccggcgtgttgcggaggagatggatgttactatcggg
gaggaagttggttacagcatccgttttgaggattgcagcagtcacaaaacagttctcaaa
tatttgacagatggtatgcttctgagagaagctatggcagacccacttttagagaggtac
aaggtgattgttcttgatgaggcccatgagcggacattagcaacagatgttctgtttggg
cttctgaaggaggttctaaagaacagacctgatttgaagcttgttgttatgagtgctacc
cttgaggctgagaaatttcagacctatttcagtggtgcaccgttgatgaaggtgcctggg
agacttcatccggttgagatcttctatacacaagaaccagaaagggactacctggaagct
gctatcaggacagttgttcagatacatatgtgtgaacctgctggagatatccttgttttc
cttactggagaggaggagattgaggatgcctgtcggaagataaataaggaaattaataac
atgggggatcaggttggcccagttaaagttgtgcctttgtattctacgctgcctccagca
atgcagcagaagatttttgaacctgctccagccccatcaagagagggaggcccagctgga
aggaaaattgttgtgtccacaaatattgctgagacatccctaaccatagatggtatagtg
tatgtgatagacccagggttttccaaacagaaggtttacaatccaaggataagggtggag
tcccttctggtgtcgccaatttcaaaggcaagtgcacatcagagagctggtcgtgctgga
agaacgcaacctgggaagtgtttcaggttatatacagagaagagttttaacgatgattta
cagccacagacatacccagaaattcttaggtcaaatctggcgaatacggttcttaccttg
aagaagcttggaattgatgatttagtgcattttgactttatggatcctcctgcaccagaa
actttgatgagggccttggaagttttgaactacttaggggcacttgatgatgatggaaac
ctcacgcctttaggtgaaacaatgagtgaatttcctctagatccccagatgtcaaagatg
cttgtcatcagtccaaaatacaactgttcaaatgagatcctttcaatatctgccatgctg
tcagtacccaattgctttctccggcctagggaggcacagaaggctgctgatgaagcgaag
gctcgatttggccacattgacggggaccacctgacacttctgaatgtataccatgcatac
aagcagaacaatgaagatccccagtggtgttatgagaacttcatcaatgccagagctcta
aagtcagctgataatgtcagacaacagcttgttcgcatcatgaccagatttaacctcaag
atgtgcagcacagacttcaatagtcgggagtactacgtcaatatcaggaaagccatgctt
gcagggtacttcatgcaggttgctcacctggagcgaacaggacattacctgaccgtcaaa
gataaccaggttgtccatcttcacccctcgaactgtctagaccataagccggagtgggtc
atctacaatgagtatgttttgaccaccagaaatttcatccgcacggtcatggatatccgt
ggtgattggctgattgatgtggctccacactattatgatcttagtaatttcccctcgtgc
gaggcaaagcgcgtccttgagaggctgtacaacaagcgggagagggaaagagctgctaat
aggaactga

DBGET integrated database retrieval system