KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332674
Entry
4332674           CDS       T01015                                 
Name
(RefSeq) guanylate kinase 2, chloroplastic/mitochondrial
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Module
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4332674
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     4332674
SSDB
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 Rad17 AAA_22 RsgA_GTPase DUF5697 adh_short
Other DBs
NCBI-GeneID: 4332674
NCBI-ProteinID: XP_015628708
UniProt: Q10M74
LinkDB
Position
3:11595455..11599070
AA seq 285 aa
MLLTRRFSSALARSPLLPRSLPPPRAVPATPPAPRPPPRRLMSSSSSGWHHSSRPPPPPP
SGADKDQLFRGLEAALGTTFSSEPLAPPPQPMILVISGPSGVGKDAVIQRLQEEREGMHF
VVTATSRAKRPGEVDGKDYYFVTKEEFLTMIERKELLEYALVYGEYKGIPKQQIRDYMAK
GYDIVLRVDIQGAATLREILGESAIFIFLVAESEEALVKRLIHRKTETSDMLLVRVATAR
EEVKRMNNFDYVVVNSEGNLEGAVKQVESIIDAEKAKVHKRTVNI
NT seq 858 nt   +upstreamnt  +downstreamnt
atgcttctcacgcgaaggttctcctccgccctcgcgcgctccccccttctccccaggtcc
ctccctcctccgcgggccgtgcccgccacccctccggcgccccgcccgccgccgcgccgc
ctcatgtcctcctcctcctccggctggcaccactcctctcgcccgcccccgccgcccccc
tccggcgccgacaaggatcagctgttccgggggctggaggcggcgctcggcacgacgttc
agctcggagccgctcgcgccgccgccgcagccgatgatcctcgtcatcagcgggcccagc
ggcgtcggcaaggacgctgtcatccagaggctgcaagaagagagggaggggatgcatttc
gttgtcaccgcgacaagcagagcgaagcggcccggtgaagttgatgggaaggactattac
ttcgtcaccaaggaggagttcctcacgatgattgaaaggaaggagttgctcgagtacgca
cttgtctatggggagtataaggggatccccaagcagcagatccgtgattacatggcgaaa
ggttatgatattgtcttgagagtggacattcaaggagcagcaaccttgagagagattctt
ggcgaatcagcaattttcatctttttggttgcagagagtgaagaggcacttgtcaaaagg
ctaattcaccgcaaaacagaaacatcagatatgcttcttgtcagagttgcaacggccaga
gaagaggtgaaacgcatgaacaattttgattatgtagttgtcaattctgaagggaatctt
gagggggctgttaaacaggtggagtctatcattgatgctgagaaggctaaggtccacaaa
cgtacggttaatatctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352344
Entry
4352344           CDS       T01015                                 
Name
(RefSeq) guanylate kinase 1
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Module
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4352344
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     4352344
SSDB
Motif
Pfam: Guanylate_kin AAA_18 Kelch_2 AAA_33 ATPase_2 AAA_22 AAA_16 AAA_17 RsgA_GTPase nSTAND3 Rad17 MMR_HSR1 AAA_28 NTPase_1 AAA_7 AAA_14 RNA_helicase T3SS_needle_E ABC_tran AAA_30 NACHT
Other DBs
NCBI-GeneID: 4352344
NCBI-ProteinID: XP_015620685
UniProt: Q2QPW1
LinkDB
Position
12:complement(20028820..20032866)
AA seq 382 aa
MGEEAPEFRVESVALESKDCLQNAIDIGDKTYVISRSDDPKSSITIKILDKLTQTWVVPT
VLGAPPNPTSSHSAVLVNNEKILIIEKGVPLNDSIWFLEVDTPFVKQQSKIKGTVVVAWS
KGVIGEGQKPIVISGPSGVGKGTLIAKLMKEYPSKFGFSVSHTTRAPREKEIDGVHYHFT
ERSKIEEEISEGKFLEFAHVHGNVYGTSVEAVESVTDEGKRCILDIDVQGARSVRASSLE
AIFIFVCPPSFEELEKRLRARGTETEEQIQKRLRNARAELDQSNSPGLFDHLLVNDDLEA
CYENLKKLLSLDDDHEDSNDSFIKDGKETACYSILSKTNSEILLQSETNEAEKGTTNLLS
LDLSLSGGAPGRTRGLKISPVN
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgggtgaagaggctccggagtttcgtgtcgagagcgtcgccttggaatccaaggactgc
ctgcagaatgccatagatataggcgataagacgtatgttatcagcagatcagatgacccc
aagtcatcgattaccatcaaaattttggacaaactaactcagacttgggttgtacctaca
gtacttggggcacctccaaatccaaccagctcacactcagcggttctcgtaaacaatgag
aagatactgattattgagaagggtgttcccttgaatgattctatctggttccttgaggta
gacactccttttgttaagcagcagagcaaaattaagggcacagttgttgttgcatggagc
aagggagtaattggtgagggccaaaagccaattgtgattagcgggccttctggtgttggt
aaagggacattaattgcaaaattaatgaaagaatatccatcaaagtttggattttctgtt
agccacaccacaagagctccaagggagaaagaaatagatggagttcattaccacttcaca
gaacgaagcaagattgaggaagagataagtgagggcaaatttcttgagtttgctcatgtt
catggaaatgtctatggcactagcgttgaagcagttgaatctgttactgatgaggggaag
aggtgtattctcgacattgatgtccaaggagctcgttctgtgagggcttcttctcttgaa
gcaatattcatctttgtatgccctccatcgttcgaggaactagagaagcgccttcgggca
cggggaactgaaacagaggagcaaatccagaagcgactgaggaatgctcgtgcagagctt
gaccagtccaattcaccaggtcttttcgatcatcttttggtaaatgatgaccttgaagct
tgttatgaaaatttgaagaagttgctttctttggatgatgaccacgaagattcaaatgat
tctttcatcaaggacgggaaagaaactgcatgttactcaatcctgtccaaaacaaactca
gaaattttgttgcaatctgagactaacgaagcagagaaaggaaccacaaacttgttatcg
ctcgacttgtctctctcaggaggtgctcctggacgaacaaggggcctcaagatatccccg
gttaactag

DBGET integrated database retrieval system