KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332802
Entry
4332802           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L22-2
  KO
K02891  large subunit ribosomal protein L22e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332802
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332802
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4332802
SSDB
Motif
Pfam: Ribosomal_L22e Glucodextran_B
Other DBs
NCBI-GeneID: 4332802
NCBI-ProteinID: XP_015630925
UniProt: Q762A6 Q0DRZ6
LinkDB
Position
3:complement(12798178..12799758)
AA seq 131 aa
MARGVAAAAGGKGGAGKKKGSVTFVIDCAKPVDDKIMEIASLEKFLQERIKVAGGKAGNL
GESVTVSRDKTKVTVTSDGPFSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYF
NIAENEGEEED
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcgcgcggcgtggcggcggcggcggggggcaagggcggcgccgggaagaagaagggc
tccgtcaccttcgtcatcgactgcgccaagcccgtcgacgacaagatcatggagatcgcg
tcgctcgagaagttcctgcaggagcgcatcaaggtcgccggaggcaaggccggcaacctc
ggcgagtccgtcaccgtctcccgcgacaagaccaaggtcaccgtcacctccgacgggccc
ttctccaagaggtacctgaagtacttgaccaagaagtacctgaagaagcacaatgtgcgt
gactggctacgggtgattgcatccaacaaggaccgcaacgtgtacgagctccggtacttc
aacatcgccgagaacgagggcgaggaggaggattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344261
Entry
4344261           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L22-2
  KO
K02891  large subunit ribosomal protein L22e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4344261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4344261
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4344261
SSDB
Motif
Pfam: Ribosomal_L22e Glucodextran_B
Other DBs
NCBI-GeneID: 4344261
NCBI-ProteinID: XP_015647764
UniProt: A3BNC4 Q6YSX0
LinkDB
Position
7:28500898..28502397
AA seq 130 aa
MARGVAVAAKGGAGGKKKGSVSFVIDCSKPVEDKIMEIASLEKFLQERIKVAGGKAGNLG
DSVTVTRDKTKVTVTSDGAFSKRYLKYLTKKYLKKHNVRDWLRVIAANKDRNVYELRYFN
IAENEGEEED
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcgcgcggcgtggcggtggcggcgaagggcggcgcgggcggcaagaagaagggctcc
gtctcgttcgtgatcgactgctccaagcccgtggaggacaagatcatggagatcgcgtcg
ctggagaagttcctgcaggagcgcatcaaggtcgccggcggcaaggccgggaacctcggc
gactccgtcaccgtcacgcgcgacaagaccaaggtcaccgtcacctccgacggggccttc
tccaagaggtatctgaagtacttgaccaagaagtacttgaagaagcacaatgtgcgggac
tggctacgtgttattgcggctaacaaggaccgcaatgtctatgagctcagatacttcaac
attgctgagaacgagggcgaggaggaagactag

DBGET integrated database retrieval system