KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332813
Entry
4332813           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S21
  KO
K02971  small subunit ribosomal protein S21e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332813
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332813
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4332813
SSDB
Motif
Pfam: Ribosomal_S21e
Other DBs
NCBI-GeneID: 4332813
NCBI-ProteinID: XP_015632039
UniProt: P35687
LinkDB
Position
3:12869350..12871138
AA seq 82 aa
MQNEEGQMVDLYVPRKCSATNRIITAKDHASVQINIGHVDENGLYDGRFTTFALSGFIRA
QGDADSALDRLWQKRKAEVKQQ
NT seq 249 nt   +upstreamnt  +downstreamnt
atgcagaacgaggagggtcagatggtggacctctacgtccccaggaagtgctcggccacg
aacaggatcatcaccgccaaggaccacgcctcggtccagatcaacattgggcatgtggat
gagaatgggctgtacgatggccgcttcaccacctttgctctctctgggttcatccgtgct
cagggagatgctgacagtgctctggataggctgtggcagaagaggaaggctgaggtcaag
cagcagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333672
Entry
4333672           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S21-like
  KO
K02971  small subunit ribosomal protein S21e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333672
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333672
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4333672
SSDB
Motif
Pfam: Ribosomal_S21e
Other DBs
NCBI-GeneID: 4333672
NCBI-ProteinID: XP_015629110
UniProt: A0A0P0W134 Q7Y199
LinkDB
Position
3:complement(26308584..26312924)
AA seq 82 aa
MQNEEGQMVDLYVPRKCSTTNRIITAKDHASVQINIGHVDENGLYDGRFTTFALSGFIRA
QGDADSALDRLWQKRKAEVKQQ
NT seq 249 nt   +upstreamnt  +downstreamnt
atgcagaacgaggagggtcagatggtggacctctacgtccccaggaagtgctcgaccacc
aacaggatcatcaccgccaaggaccatgcctcggtccagatcaacattgggcatgtggat
gagaatgggctgtacgatggccgcttcaccacgtttgctctctctgggttcatccgtgct
cagggagacgccgacagtgctctggataggctgtggcagaagaggaaggctgaggtcaag
cagcagtag

DBGET integrated database retrieval system