KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332868
Entry
4332868           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L6, chloroplastic
  KO
K02933  large subunit ribosomal protein L6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332868
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332868
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4332868
  Bacteria
    4332868
  Archaea
    4332868
SSDB
Motif
Pfam: Ribosomal_L6
Other DBs
NCBI-GeneID: 4332868
NCBI-ProteinID: XP_015628709
UniProt: Q10L93 Q0DRT5
LinkDB
Position
3:complement(13627590..13630355)
AA seq 226 aa
MASLSPSLHLPCNSRTGFAGKTQGIRLRVIPAGRVGFVRTTVECKESRIGKKPIEVPSNV
TLTLEEQFIKAKGPLGELSLNYPGEVKVVKEESGKLRVSKTVETKRANQMHGLFRTLTDN
IIVGVSKGFDKKLQLVGVGYRAAVEGKDLVMNLGFSHPVRMAVPEGLKVKVEENTRIIVS
GYDKSEIGQFAASIKKWRPPEPYKGKGIRYADEIVRRKEGKAGKKK
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcgtccctctccccttccctccacctcccttgcaattcaaggactggctttgctgga
aagacacaagggattcgtcttcgtgttatccctgctggcagagttggttttgtcagaaca
acagtggagtgcaaagaatctagaataggaaagaagccgatcgaagtgccatcaaatgtg
accctcacgttagaggagcagtttattaaggctaagggtccattaggagaattatcacta
aactatccaggtgaagtaaaagtggtgaaagaagaatctggtaagctgagagtttccaag
actgtggagaccaaaagggcaaaccagatgcatggccttttcaggaccctgactgacaac
atcatcgtaggtgtgtcaaaggggtttgataagaagcttcagctagttggggttggatac
cgtgcagcggtggagggtaaagatcttgtgatgaacctgggattttcgcacccggttcgg
atggctgttccagaaggcctgaaagttaaggtggaagagaacaccaggatcattgtgagt
ggctacgacaagagcgagatcggtcaattcgctgcttccataaagaagtggaggccgcct
gaaccatacaaggggaagggcatccggtatgccgatgagatcgtcagaagaaaggagggc
aaggctgggaagaagaaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333960
Entry
4333960           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L6, mitochondrial
  KO
K02933  large subunit ribosomal protein L6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333960
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4333960
  Bacteria
    4333960
  Archaea
    4333960
SSDB
Motif
Pfam: Ribosomal_L6
Other DBs
NCBI-GeneID: 4333960
NCBI-ProteinID: XP_015627922
UniProt: A0A0P0W2C8 Q6AU10
LinkDB
Position
3:29462919..29465692
AA seq 103 aa
MEAKVFRFLKLVGVGFKARTEREGRELFLKLGYSHEVQFTAPPAVRVFCFKPNLICCTGI
DKNRVHNFAGAVRNCKPPEVYKGKGILYIDEVIKLKPGKKQKK
NT seq 312 nt   +upstreamnt  +downstreamnt
atggaggccaaggttttcaggtttctgaagcttgtcggagttggcttcaaagcaaggaca
gagcgtgaaggccgtgagttgtttctgaaacttggttacagccatgaggtgcagttcact
gctccacctgctgttcgtgtcttctgcttcaaacccaacttaatttgctgtactggtatc
gacaagaatcgggtgcacaactttgcgggcgctgttcggaactgtaagcctccagaggta
tacaaagggaaaggcatattgtacattgatgaagttatcaagctgaagccagggaagaag
caaaagaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334131
Entry
4334131           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L6, chloroplastic
  KO
K02933  large subunit ribosomal protein L6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4334131
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4334131
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4334131
  Bacteria
    4334131
  Archaea
    4334131
SSDB
Motif
Pfam: Ribosomal_L6
Other DBs
NCBI-GeneID: 4334131
NCBI-ProteinID: XP_015627881
UniProt: A3AMR4 Q850L8
LinkDB
Position
3:30981020..30984554
AA seq 226 aa
MASLSLSLHHPCNSRTGFLGKRQGICLHVIPAGRVGFVRKTIECKESRIGKKPIEVPSNV
TLTLEEQFIKAKGPLGELSLNYPGEVKVVKEESGKLRVSKTVETKRANQMHGLFRTLTDN
IIVGVSKGFDKKLQLVGVGYRAAVEGKDLVMNLGFSHPVRMAVPEGLKVKVEENTRIIVS
GYDKSEIGQFAASIKKWRPPEPYKGKGIRYADEVVRRKEGKAGKKK
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcgtccctctccctttccctccaccacccgtgcaattcaagaacaggcttccttgga
aagagacaagggatttgtcttcatgttatccctgctggcagagttggttttgtcagaaaa
acaattgagtgcaaggaatctagaattggaaagaaaccgatagaagttccatcaaatgtt
actcttacattagaggagcaatttataaaagctaagggtccattgggagagttatcacta
aactatccaggtgaagtaaaagtggtgaaagaagaatctggtaagctgagagtctccaaa
acagtggaaaccaaaagggcaaaccagatgcatggacttttcaggaccctgacggacaac
atcatcgtaggggtatcaaaagggtttgacaagaagcttcagttagttggggtcgggtac
cgtgcagctgtagaaggcaaagatctcgtgatgaatttgggattctcgcatcctgttcgg
atggctgttcctgaaggcctgaaggttaaggtggaagagaacaccaggatcatcgtgagt
ggctacgacaagagtgagattggccagtttgctgcctccataaagaagtggaggccacct
gagccgtacaaggggaagggaatccgatacgccgatgaggttgtcagaagaaaggagggt
aaagctgggaaaaagaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269245
Entry
9269245           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L6, mitochondrial
  KO
K02933  large subunit ribosomal protein L6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9269245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9269245
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    9269245
  Bacteria
    9269245
  Archaea
    9269245
SSDB
Motif
Pfam: Ribosomal_L6
Other DBs
NCBI-GeneID: 9269245
NCBI-ProteinID: XP_015648894
UniProt: Q6YTT6
LinkDB
Position
8:complement(23923640..23925852)
AA seq 103 aa
MEAKFFRFLKLVGVGFKARTEREGRELFLKLGYSHEVQFTAPPAVRVFCFKPNLICCTGI
DKNRVHHFAGAVRNSKTPEVYKGKGILYIDEVIKLKPGKKQKK
NT seq 312 nt   +upstreamnt  +downstreamnt
atggaagccaagtttttccggtttctgaagcttgtcggggtcggcttcaaagcaaggaca
gagcgtgaaggccgtgagttgtttctgaaacttggttacagccacgaggtgcagttcact
gctccacctgccgttcgtgtcttctgctttaaacccaacttaatatgctgtactggtata
gacaagaatagggtacaccactttgctggcgctgttcgaaacagtaaaactccagaagta
tacaaggggaaaggcatattgtacattgatgaagttataaagctaaagccagggaagaag
caaaagaagtaa

DBGET integrated database retrieval system