KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332978
Entry
4332978           CDS       T01015                                 
Name
(RefSeq) probable F-actin-capping protein subunit beta isoform X1
  KO
K10365  capping protein (actin filament) muscle Z-line, beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4332978
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4332978
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4332978
   04147 Exosome [BR:osa04147]
    4332978
Membrane trafficking [BR:osa04131]
 Protein recycling
  Others
   WASH complex
    4332978
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     4332978
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4332978
SSDB
Motif
Pfam: F_actin_cap_B
Other DBs
NCBI-GeneID: 4332978
NCBI-ProteinID: XP_015631455
UniProt: Q75M66 A0A0P0VYZ3
LinkDB
Position
3:15115095..15118338
AA seq 252 aa
MEAAMDLMRRMPPGRAETALNALLSLIPDHSLDLLSQVDLPLQVCMDKESVKEYILCEYN
RDADSYRSPWSNKYDPPLEDGTVPSEEMRNLEVEANDVFSVYRDQYYEGGISSVYIWEDE
DESFIACFLIKKDGEGKRGHMQIGSWDAIHVIQVGPEEEGAAHYCLNSTVMLSLTTDNKQ
SGTFNLSGSIRRQMSMTLAVADGHLVNMGKMIEEMEGKLRNSLDQVYFGKTREMVCTLRP
PPEVLNRRLPDS
NT seq 759 nt   +upstreamnt  +downstreamnt
atggaggcggcgatggatctgatgcggcggatgccgccggggagggcggagacggcgctg
aacgcgctgctctccctcatccccgaccactccctcgacctcctctcccaggtcgacctc
ccgctccaggtttgcatggacaaggagagcgtgaaggaatacatcctatgcgagtacaac
cgtgacgctgactcctacaggtctccttggtcaaacaaatacgatcctcctttggaagat
ggaacagttccctccgaagagatgaggaatcttgaagttgaggcaaatgatgttttctct
gtctaccgtgaccagtattacgaaggtggcatctcttctgtgtatatttgggaggatgaa
gatgagagttttattgcatgcttcttaataaagaaagatggagaaggaaaaagagggcac
atgcagattggttcatgggatgctattcatgtcattcaggttggtcctgaagaagaagga
gcagcgcattactgcttgaacagcactgtgatgctatcattgacaacagataacaagcaa
tctggaactttcaacttgtcgggatcaatcaggcggcagatgagtatgactcttgctgtg
gcagatgggcacctggttaatatgggaaaaatgatagaagaaatggagggcaagctcaga
aattcgttggaccaggtttattttgggaagaccagagagatggtttgcacgcttcggcca
ccacccgaagtattaaacaggaggctacctgacagctga

DBGET integrated database retrieval system