KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332999
Entry
4332999           CDS       T01015                                 
Name
(RefSeq) intron-binding protein aquarius
  KO
K12874  intron-binding protein aquarius
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332999
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332999
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4332999
 Complex C
    4332999
SSDB
Motif
Pfam: Aquarius_N AAA_11 AAA_12 AAA_19 AAA_30 UvrD_C_2 AAA DUF2075 AAA_22 ResIII AAA_16
Other DBs
NCBI-GeneID: 4332999
NCBI-ProteinID: XP_015631480
UniProt: Q6AVE6
LinkDB
Position
3:15410207..15419656
AA seq 1572 aa
MPKVYGTGVFEFRHPRAAEYPLPADVPASAASAPDKAIPTAAASTITLLDIQRDRLTRVA
AEHWGAPTAGAAFDAALVREIYATELRVEGRGRKTVPLHRVMILEVSQYLENYLWPNFDP
AGASFEHVMSMILMVNEKFRENVAAWTCFHDRKDAFKGFLWRVLKLKEEDRELNMAEKTN
YLLFMINAFQSLEDELVRETILQLVSLKLWHTLSFGRLQMELCLNPELIKKWTKIKRKEA
KEAKKAGQTCDASEMLENRFLRNLIEEFLEILDSKVILSSQDGGDESVLNVSLSGQVDDY
CVLYCERFMEFLIDMLSQLPTRRFLRPLVADVAVVAKCHLSALYTHEKGRLFAQLVDLLQ
FYEGFEINDHSGTQLSDDDVLQAHYSRFQAFQLLAFKQVPKLRDFSLCNIGSIHKRADLA
KKLLVLTDVELQDLVCNKLKLISEEDPCSGRRDFLIEVLVAFFEKRQSQKDAVNALPLYP
NEQIMWDESLVPSINYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYEIREDIQEA
VPHLHAYINNEGDTAFRGWSRMAVPIKEFRITEVKQPNIGEVKPSAVTADVTFSISSYKP
QIKSEWDALKEHDVLFLLSIRPSFEPLSPEEAAKSTVPERLGLQCVRGCEVIEIRDEEGS
LMNDFTGRIKREEWKPPKGEIRTVKIALDTAQYHIDVTEVAEKGAENVYGTFNILMRRKP
KENNFKAILESIRDLMNETCVVPEWLHNIFLGYGNPSAAQWINMPDLLENIDFKDTFLDA
DHVVQSFPDYQVTFINSDGTENLNPSPPFKIKLSKKMRESSHALPGNVNSVLSAKNNMVD
DDGPQKEKIMVETYIPADPGPYPQDKPKQNSVRFTPTQIGAIISGIQPGLTMVVGPPGTG
KTDTAVQILNVLYHNCPSQRTLIITHSNQALNDLFEKIMQRDVPARYLLRLGQGEQELAT
DLDFSRQGRVNAMLVRRLELLGEVAKLASSLHLPEDVSYTCETAAYFWLLHVYARWEQFL
AACAQNQDKPSFVKDRFPFSEFFSDTPQPTFTGESFEKDMHAAKGCFKHLLTIFQELEEC
RAFELLKSTAERANYLMTKQAKIVAMTCTHAALKRRDFLQLGFKYDNLLMEESAQILEIE
TFIPMLLQRQEDGYARLKRCILIGDHHQLPPVVKNMAFQKYSHMDQSLFTRFVRLGVPYI
ELNAQGRARPSIAELYNWRYRELGDLPYVREEAIFHKANSGFSYDYQLVDVPDFRGRGES
APSPWFYQNEGEAEFIVSVYIYMRLIGYPANKISILTTYNGQKLLIRDVINRRCKPWNIE
PPSKVTTVDKFQGQQNDFILLSLVRTRFVGHLRDVRRLIVAMSRARLGLYVFCRRSLFEQ
CYELQPTFQLLLQRPDKLGLNLEECTPFTERPLEETGNIHYVAGIEDIGHLVNFRLEHLR
QMQYMQYYAPHANVPPSAVPENNADATENGNAGNGMHKANDVMAEENGDAVMRNKMEEDT
IDTMQEENKMDGKNPEANDMAMEEKTVDGDDDPKNKMEEGNTEAKNKMEEGNTEAKDKME
EENDVAKNNMEE
NT seq 4719 nt   +upstreamnt  +downstreamnt
atgccgaaggtctacggcaccggcgtcttcgagttccgccacccgcgcgccgccgagtac
ccgctcccggccgacgtcccggcctccgccgcgtcggcgcccgacaaggccatccccacc
gccgcggcctccaccatcacgctcctcgacatccagcgcgaccgcctcacccgcgtcgcc
gccgagcactggggcgcgcccaccgcgggggccgccttcgacgccgccctcgtcagggag
atctacgcgaccgagctccgggtcgagggccgcggccgcaagaccgtcccgctccaccgc
gtcatgatcctcgaggtcagccagtacctcgagaactacctctggccaaacttcgacccg
gccggcgcctccttcgagcacgtcatgtccatgatcctcatggtcaacgagaagttccgg
gagaatgtggcggcgtggacctgcttccatgaccggaaggatgctttcaagggattttta
tggcgggttctcaagctaaaggaagaggatagggagcttaatatggccgagaaaacaaac
tacctgttgttcatgataaatgcgtttcagagtttggaggatgaactagttcgagaaacc
atacttcagttagtaagcctaaagttgtggcatactctttcttttggacggcttcagatg
gagctttgccttaaccctgaattgattaagaagtggaccaaaatcaaaagaaaagaagct
aaagaagcaaaaaaggcaggtcaaacctgtgatgcttcagaaatgctcgagaatagattc
cttaggaacttaatagaagaattcctggagattcttgattcgaaggtaatattgtccagt
caagatggtggggatgaatctgtgttgaatgtatcactcagtgggcaggttgatgattat
tgtgtcttgtactgtgagagattcatggagtttttgattgatatgttgagccagcttcct
actagacgatttttaaggccccttgttgccgatgtagctgttgttgctaagtgtcactta
agtgcactgtatacccatgaaaaggggcgtctttttgcgcagttggttgatttgctgcag
ttttatgaaggctttgagattaatgatcattctggaacacagctcagtgatgatgatgtc
ttgcaagctcattattcccgtttccaagcctttcagctgctggccttcaaacaagtgcct
aagttgagagatttttccttgtgtaatattggttcaatccataagcgtgcggacttagca
aagaagctgcttgtcttgacagatgtagaactgcaagatctggtttgtaataagctcaag
ttaatttcagaggaggacccatgcagtggaagacgtgattttcttattgaggtcctggtt
gccttttttgagaagcgtcagtcacagaaagatgcagtaaatgcacttcctctttatcca
aatgaacagatcatgtgggatgaaagccttgttcctagcattaattattctggagagggc
tgccttgctctcccaaaactcaatctccagtttttaacacttcatgattatttattgagg
aatttcaatcttttccgccttgaatcaacatatgaaattcgtgaagacatccaggaagct
gttcctcatctgcatgcctatattaacaatgagggagacactgcctttcgtggttggtcc
aggatggctgttccaatcaaggaatttaggattactgaagtgaagcagccaaacattgga
gaagttaagccatctgctgtaactgctgatgtcactttcagcatctcaagctacaagcca
cagatcaaatctgaatgggatgctttgaaggaacatgatgttttatttttgttgtcgatc
cgtccatcttttgaaccccttagccctgaggaggctgcaaaatcaactgtgccagaaagg
cttggattacaatgtgtacgtggatgtgaggttattgaaattcgtgatgaggaaggatct
cttatgaatgattttacagggaggataaagagagaggaatggaaacctcccaagggtgag
attcgtactgttaaaattgctttggatacagctcagtatcatattgatgttactgaggta
gcagagaagggtgcagagaatgtgtatgggacatttaacattctaatgagaaggaaaccc
aaggagaataatttcaaagcgatattggaatctatacgtgatctaatgaatgaaacatgt
gtagttcctgaatggttgcataacatattcttgggttatgggaacccttctgccgcacag
tggataaatatgcctgatcttctggaaaatatagattttaaggacacttttcttgatgcg
gaccatgttgtacaaagctttccagattaccaggtcacatttatcaattcagatggaaca
gaaaacctgaatccgagccctccttttaagattaagttgtccaagaaaatgagggaaagt
agtcatgctctacctggcaatgtaaactctgttttgtcggctaagaacaatatggttgat
gatgatgggccccagaaagaaaaaataatggttgagacttatattcctgctgatccaggg
ccgtatcctcaagataaacctaaacagaactcagtgaggtttacacctactcagattggt
gctataatatctggtattcaacctgggttgacaatggttgttggtcctcctggtacggga
aaaacagatacagctgtgcagatattgaatgttttatatcacaactgtccttcccaaaga
actctaattataactcattccaatcaagctttgaatgatttgtttgagaagataatgcag
agagatgtgcctgctaggtaccttcttcgtcttggtcagggtgaacaagagttggcaact
gatctcgattttagccgtcaaggtcgtgtcaatgctatgctggttcggcgattagagctg
ctaggtgaagttgcaaaattggcaagttcccttcatcttcctgaagatgtgagctacaca
tgtgaaacggctgcatacttttggttattacatgtttatgctcgctgggaacaattttta
gctgcctgtgcgcaaaaccaagacaagccctcatttgttaaagaccgcttccctttctca
gagttcttctcagatactccacaacctaccttcactggtgagtcctttgagaaagatatg
catgcagccaaaggttgtttcaaacatcttttgacaatatttcaagagctggaagaatgt
agggcttttgagctacttaagtcaacagcagagagggcaaattatctaatgaccaaacaa
gccaagattgttgccatgacttgtactcatgcggcattgaagaggagagactttcttcag
ttagggttcaaatacgataatttgctgatggaagaaagtgcacagatattagagatagag
actttcataccgatgctgctgcaacggcaggaagatggctatgctcgtctgaaacgttgc
attttaattggtgatcaccatcagttaccccctgtcgtgaagaacatggcttttcagaag
tacagccacatggaccaaagtctctttacaagatttgttcgtcttggtgtcccttacatt
gagctcaatgctcaggggcgtgccagacctagcatcgccgaactatataactggagatac
agagaacttggagatctaccttacgtccgtgaggaggctatcttccacaaagctaattct
ggcttctcttatgactatcagttggttgatgttcctgatttccgtggcagaggtgagtct
gccccttctccttggttctaccagaatgaaggggaggctgagtttatagttagtgtctac
atctacatgcgcctgattggataccctgccaataagatttcgatattgaccacttacaat
ggtcagaagcttcttattcgcgatgttattaacagaagatgcaagccatggaatatcgaa
ccacctagcaaggttaccacagtggacaagttccagggtcaacaaaatgatttcatttta
ttatctcttgtccgcacccgttttgtggggcatcttcgtgatgtcagaagacttattgtg
gcaatgtcccgtgctcgtctgggcctgtatgtgttctgccgtcgttcactttttgaacag
tgctacgaattgcagccaacattccagcttctcctccagaggcctgataagcttggcttg
aatcttgaagagtgcacaccatttacagagcgacctttagaggaaactggaaatattcat
tatgttgctggtattgaagatattggtcatctagtgaatttcagattagaacatcttcgt
cagatgcaatacatgcaatattatgcacctcatgcaaatgtaccaccttcagcagtacca
gaaaacaatgctgatgcaactgaaaatggcaatgctggcaatggtatgcataaggcaaac
gatgtcatggctgaagaaaatggtgatgcagtgatgagaaataagatggaggaagacact
attgatacaatgcaggaagaaaacaagatggatggtaaaaatcctgaggcaaacgacatg
gctatggaggagaagaccgtcgacggagatgatgatccaaagaataagatggaggaagga
aatactgaggcaaagaataagatggaggaaggaaatactgaggcaaaggacaagatggag
gaagaaaatgatgtggcaaagaacaatatggaagagtga

DBGET integrated database retrieval system