KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333066
Entry
4333066           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase III subunit 2 isoform X1
  KO
K03021  DNA-directed RNA polymerase III subunit RPC2 [EC:2.7.7.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4333066
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4333066
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     4333066
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     4333066
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_7 RNA_pol_Rpb2_4 RNA_pol_Rpb2_2 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5
Other DBs
NCBI-GeneID: 4333066
NCBI-ProteinID: XP_015632810
UniProt: Q10JZ3 Q0DRA1
LinkDB
Position
3:16421017..16439540
AA seq 1155 aa
MERTEEEEAPAAKDPNASLPSPTYRSLAAPVTKPVDKFALLPAFLKVRGLVKEHIDSFNY
FITKGIRNIVKANNRIEARNNPSIFLRYNSVRVGVPSVQVQYIAEKITPHFCRLTDRTYS
APVLADIEYTVGKQYELKRKPNFIIGYLPIMLRSHACVLNGKDEAELARYGECPLDPGGY
FIVKGTEKVILIQEQLSKNRIIIDTDSKGRVIASVTSSTHEIKSKTVIFMEKEKIYLQLN
QFTKPIPIIVVMKAMGMESDQEVAQMVGRDPRYGDLLYPSIQECAFERIYTQKQALQYMD
DKVMYPGAGNQKEGRSKSILRDVFVAHVPVESGNFRPKCIYTAVMLRRMMDAILNADTFD
DKDYVGNKRLELSGQLISLLFEDLFKTMNSNAVELMNKTSEKIHSSPLDLSLHIKENIIT
HGLERAISTGNWDIKRFRMHRKGVSQVLSRLSYMASLGYMTRITPQFEKTRKTSGPRALQ
PSQWGMLCPCDTPEGEACGLTKNLALLTHVTTDQEEGPLMNLCYSLGVEDLSLLSGEEIH
ASGSFLVMFNGLILGKHRQPQRFANAMRKLRRSGIIGEFVSIFVNEKQHCIHIASDGGRV
CRPLIIADKGIPRVKEHHMKQLRDGIRSFDDFLRDGLIEYLDVNEENNALIALYEHEDQD
DVQRSSITHIEIEPLTILGVVAGLIPYPHHNQSPRNTYQCAMGKQAMGNIAYNQLFRADS
LLYLLVYAQRPLLTTKTIELVGYDKLGAGQNATVAVMSYSGYDIEDAIVMNKSSLDRGFG
RCIAMKKYTVTKEKYEGGYSDRIVKPQRDKDGALLKQNMRALDEDGFAAPGLIIRNHDIY
VNKQTPRNTKRDSGAHLTDRDYKDSPAVYKGVDGETTVVDRVMLCSDTDEKLIIKCIIRH
TRRPEVGDKFSSRHGQKGVCGTIVQQEDFPFSERGICPDLIMNPHGFPSRMTIGKMIELL
GGKAGVSCGQFHYGSAFGEPSGNADKVEDISRTLVKHGFSYNGKDLLYSGILGHPCQAYV
FMGPIYYQKLKHMVLDKMHARASGPRVLLTRQPTEGRSRDGGLRLGEMERDCLIAYGASM
LIFERLLISSDPYQVQVCRKCGLLGYYNHKLKASYCSMCKNGENMAKMRMPYACKLLFQE
LQAMNVVPRLKLTEG
NT seq 3468 nt   +upstreamnt  +downstreamnt
atggaacgcactgaggaggaggaggcgcccgccgccaaggaccccaacgcgtcgctgccg
tcgccgacgtacaggtcgctcgccgcgcccgtcaccaagcccgtcgacaagttcgcgctc
cttcctgccttcctcaaggttagaggcctcgttaaggagcacatcgactccttcaactac
ttcatcaccaagggaattaggaacattgtcaaggcaaacaatcgcatcgaagcgcgcaac
aacccctctatttttcttaggtacaatagtgtaagggttggtgtgccctccgtacaagta
caatacatcgctgaaaaaatcacgccacacttttgccgccttaccgatcgcacatactct
gctcctgtgttggctgatattgaatacacagttggaaagcagtatgagctgaaaaggaag
cctaatttcatcattgggtacttgccaattatgcttagaagtcatgcatgcgttctgaat
ggaaaggatgaagctgaattagcaagatatggtgagtgccctcttgatcctggtggttac
ttcattgttaagggaaccgagaaggtcattcttatacaagaacagctatcaaagaatcgt
attattatcgacaccgatagtaaaggaagggtgattgcatctgttacgagcagcacacat
gaaataaaaagcaaaactgtgatttttatggagaaggagaaaatttatctacagttgaat
caattcactaagccgatacctataattgtggttatgaaagcgatggggatggaaagtgac
caagaggttgcacaaatggtcggaagagatccaagatatggagatctcctatatccatct
attcaggaatgtgcctttgagagaatctatacacagaagcaagctctgcagtacatggat
gacaaggtgatgtatcctggtgcaggaaatcagaaggaaggtcgttcaaaatcaatcctc
cgtgatgtttttgttgcacatgttccggttgaaagcgggaatttccgaccaaagtgcata
tacacagctgttatgttaaggcgcatgatggatgcaatcttgaatgccgacacttttgat
gataaggattatgtaggaaataagaggctagagctgtctggtcaactaatatccctgctt
tttgaggatttgttcaaaacgatgaactccaatgctgtggagcttatgaacaaaacaagt
gaaaagatccattctagcccattggatttaagcctgcatataaaggaaaatatcataacc
catggtttggagagggctatttccacaggaaattgggatattaaacgatttaggatgcat
agaaaaggtgtatcacaggttctttcaagattatcctacatggcatctttaggctatatg
acaaggataacaccacaatttgagaagacccggaaaacaagtggacctcgtgctttgcag
cctagtcagtggggtatgctttgtccatgtgatactcctgaaggggaggcttgtggcttg
acaaaaaatttagctttgttgacccacgttacaacagatcaagaggaaggcccactcatg
aatctctgttatagtctaggtgtggaagatttatcacttctgtctggagaagaaatccat
gcatcgggttcgtttttggtcatgttcaatgggttaatactggggaaacacagacaacct
cagagatttgctaatgctatgagaaaattgcgtcgttcgggtataattggagagttcgta
agcatttttgtaaacgagaagcagcattgcattcacattgcctctgatggcggtcgtgtc
tgtcgcccacttataattgctgataaggggataccaagagtcaaagagcatcatatgaaa
caattgagagatggtattcgttcgtttgatgattttctgcgtgatgggttgatcgaatat
cttgacgttaatgaagaaaacaatgcattgattgccctgtatgagcatgaggatcaagat
gatgttcaaagaagcagtatcacacatattgaaatagagcccttgaccattttaggggtt
gtagctggacttattccttatccacatcataaccagtctccccgtaacacttaccagtgt
gcaatgggtaagcaagcaatgggaaatatcgcgtataatcagttattccgagcagattct
ctactctatttactagtgtatgcacagcgtccccttcttacaacaaaaactattgagttg
gttggatatgataagcttggggctggacagaatgcaactgttgctgtcatgagttatagt
ggatacgatattgaagatgcaattgtaatgaacaaatcatcccttgaccgaggttttggt
cgttgcattgcaatgaaaaagtacactgtgacaaaggagaagtatgaaggtggttattca
gacaggatcgttaagccccagagggataaagatggtgctctgttaaaacagaacatgcgg
gcattggatgaagatggatttgctgcaccaggtctaataatacgcaatcatgatatctat
gtgaacaagcaaactcccagaaataccaagagagattctggtgctcatttaacagacagg
gactataaggactcgcctgctgtctacaaaggtgttgatggcgagaccactgttgtagat
cgtgtaatgctttgttcagatacagatgagaaattaatcatcaaatgtattatccgtcac
actaggcgtccagaggttggtgacaaattcagtagcagacatggacagaaaggtgtttgt
ggtaccattgttcagcaggaagacttccccttctctgagagaggaatatgccctgatttg
attatgaatccccatggatttccaagtcgaatgacaataggtaaaatgattgaacttctt
ggggggaaggctggcgtatcttgtggtcaatttcattatggcagtgcatttggggaacca
agtggtaatgctgataaggttgaagatataagccgtactctggtaaagcatggcttcagc
tataatggaaaagatctcttgtactcaggaattttaggccatccttgtcaggcatatgta
ttcatggggccaatctactaccagaagttgaagcacatggttcttgataagatgcatgct
cgagctagtggaccacgagtattgctgacccggcaacctactgaagggcgaagtcgtgat
ggaggcctacgtcttggtgagatggagcgtgactgtttaatcgcatacggtgctagcatg
ctaatctttgaacgtctactaatatctagtgatccatatcaagtacaggtttgcagaaaa
tgtggcttgttaggctattacaatcataaactgaaggcttcctactgttccatgtgcaaa
aatggagaaaatatggccaagatgaggatgccgtatgcttgcaagcttttattccaggag
ctgcaagcaatgaacgttgttccacgattgaagttaactgaaggataa

DBGET integrated database retrieval system