KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333084
Entry
4333084           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 9
  KO
K03133  transcription initiation factor TFIID subunit 9B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4333084
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4333084
   03036 Chromosome and associated proteins [BR:osa03036]
    4333084
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4333084
   Coactivators
    SAGA/TFTC/STAGA complex
     4333084
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     4333084
    STAGA complex
     4333084
    TFTC complex
     4333084
    SAGA complex
     4333084
    SLIK complex
     4333084
SSDB
Motif
Pfam: TFIID-31kDa CENP-S DUF5877 CENP-T_C Bromo_TP
Other DBs
NCBI-GeneID: 4333084
NCBI-ProteinID: XP_015627953
UniProt: Q10JT5
LinkDB
Position
3:16794243..16799501
AA seq 224 aa
MDPGGLRPAPQSAAAAAAAAAAGAGAGASAADEPRDARVVRELLRSMGLSEGEYEPRVVH
QFLDLAYRYVGDVLGDAQVYADHAGKPQLDADDVRLAIQSKVNFSFSQPPPREVLLEVAR
NRNKIPLPKSIAPPGSIPLPPEQDTLLSQNYQLLAPLKPPPQFEETEDDNAGANPTPTSN
PSNPSPNNLQEQQQLPQHGQRVSFQLNAVAAAKRRGTMDQLNMG
NT seq 675 nt   +upstreamnt  +downstreamnt
atggaccccggcggcctgcgcccagcgccccagtcggccgccgccgccgccgccgccgcg
gctgcgggggcgggggcgggggcgtccgcggcggacgagccccgcgacgcgcgcgtggtg
cgggagctcctgcgctccatggggctgagcgagggggagtacgagccgcgggtggtgcac
cagttcctcgacctggcctaccgctacgtcggcgacgtgctcggggacgcccaggtctac
gccgaccacgcggggaagccccagcttgacgccgacgacgtccgcctcgccatccagtcc
aaggtcaacttctccttctcccagccgccgccccgcgaggttctccttgaggtggcacgg
aaccggaacaaaatcccgctacccaagtcgattgctccacctggctcaattcctctgcca
ccagagcaggacacgctgttgagccaaaattaccagctcctagctccgttgaagccaccg
cctcagtttgaagaaacagaagatgacaatgcaggagccaaccctactccaacctcaaac
ccgagcaaccctagtccaaacaatctgcaggagcagcagcagcttccgcagcatggtcag
agggtttctttccagctcaacgccgttgctgccgccaaacgccgagggaccatggatcag
ttgaacatgggctaa

DBGET integrated database retrieval system