KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333148
Entry
4333148           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S19
  KO
K02966  small subunit ribosomal protein S19e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333148
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333148
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4333148
  Archaea
    4333148
SSDB
Motif
Pfam: Ribosomal_S19e
Other DBs
NCBI-GeneID: 4333148
NCBI-ProteinID: XP_015630640
UniProt: P40978
LinkDB
Position
3:17714861..17716749
AA seq 146 aa
MADSTARTVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRA
ASIARKIYLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMGIIDVDP
KGGRLITSQGRRDLDQVAGRVDVTIA
NT seq 441 nt   +upstreamnt  +downstreamnt
atggcggattcgacggcgaggacggtgaaggacgtgaaccctcatgagttcgtcaaggcc
tactccgcccacctcaagcgctccggcaagatggagctccctgagtgggttgacatcgtg
aagactgcgaggttcaaggagctccctccttatgatccggactggtactacacgagggct
gcctcgattgcaaggaagatctacctgaggcagggtattggtgtaggtggcttccagaag
atctatggtggccgccagaggaatggctcacgtcccccgcacttctgcaagagcagcggc
gctatctcacgcaacatccttcagcagctgcagaagatgggcatcatcgatgtcgacccc
aagggcggaagactcatcacctcccagggaaggcgtgatctggaccaagtggccggaaga
gttgatgttaccatcgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333150
Entry
4333150           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S19
  KO
K02966  small subunit ribosomal protein S19e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333150
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4333150
  Archaea
    4333150
SSDB
Motif
Pfam: Ribosomal_S19e
Other DBs
NCBI-GeneID: 4333150
NCBI-ProteinID: XP_015630639
UniProt: P40978
LinkDB
Position
3:17727022..17728856
AA seq 146 aa
MADSTARTVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRA
ASIARKIYLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMGIIDVDP
KGGRLITSQGRRDLDQVAGRVDVTIA
NT seq 441 nt   +upstreamnt  +downstreamnt
atggcggattcgacggcgaggacggtgaaggacgtgaaccctcatgagttcgtcaaggcc
tactccgcccacctcaagcgctccggcaagatggagctccctgagtgggttgacatcgtg
aagactgcgaggttcaaggagctccctccttatgatccggactggtactacacgagggct
gcctcgattgcaaggaagatctacctgaggcagggtattggtgtaggtggcttccagaag
atctatggtggccgccagaggaacggctcacgccccccgcacttctgcaagagcagcggc
gctatctcacgcaacatccttcagcagctgcagaagatgggcatcattgatgtcgacccg
aagggtggaagactcatcacctcccagggaaggcgtgatctggaccaagtggccggaaga
gttgatgttaccatcgcctga

DBGET integrated database retrieval system