KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333181
Entry
4333181           CDS       T01015                                 
Name
(RefSeq) pyruvate, phosphate dikinase 2
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00169  CAM (Crassulacean acid metabolism), light
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4333181
   00620 Pyruvate metabolism
    4333181
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4333181
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     4333181
SSDB
Motif
Pfam: PEP-utilizers_C PPDK_N PEP-utilizers HpcH_HpaI SAM_HAT_C
Other DBs
NCBI-GeneID: 4333181
NCBI-ProteinID: XP_015633061
UniProt: Q75KR1
LinkDB
Position
3:complement(18153168..18160124)
AA seq 887 aa
MAPAAHRDGAAEAVGQRVFHFGKGRSDGNKTMKDLLGGKGANLAEMASIGLSVPPGFTVS
TEACQQYQAQKAMPAGLWDEILAALTWVEGNMGAVLGDPRRPLLLSVRSGAAVSMPGMMD
TVLNLGLNDHVVAGLAHRSGERFAYDSYRRFLDMFGNVVMDIPHSLFEEKIEAMKAALGL
RNDTELTARDLKELVAQYKNVYVEAKGEEFPSDPKKQLHLSVLAVFNSWDSARAKKYRSI
NQITGLKGTAVNVQCMVFGNMGDTSGTGVLFTRNPSTGERKLYGEFLVNAQGEDVVAGIR
TPQDLDTMKDCMPEPYAELVENCKILESHYKEMMDIEFTVQENRLWMLQCRTGKRTGKGA
VKIAVDMVNEGLIDRRSAIKMVEPRHLDQLLHPQFESPSSYGDKVIATGLPASPGAAVGQ
IVFTADDAEAWHAQGKSVILVRTETSPEDVGGMNAAAGILTARGGMTSHAAVVARGWGKC
CVAGCSGIRVNDAEKVVLVADKVLCEGEWLSLNGSTGEVILGKLPLSPPALSGDLGEFMS
WVDEVKKLKVKANADTPADALTARNNGAEGIGLCRTEHMFFSSDERIKAMRQMIMAETIE
HRQIALDRLLPYQRLDFEGIFRAMDGLPVTIRLLDPPLHEFLPEGNVEDMVRLLSSGNVY
TQEEILTRIEKLSEVNPMLGFRGCRLGISYPELTAMQARAIFEAAISMTEQGVKVFPEIM
VPLIGTPQELAQQVDVIREVAEKVFANAETTISYKIGSMIEVPRAALIADEIAALAEFFS
FGTNDLTQMTFGYSRDDVGKFLPTYLSKGILQNDPFEVFDQKGVGELVKVAVERGRKARP
DLEVGICGEHGGEPSSVAFFAKVGLNYVSCSPFRVPIARLAAAQVML
NT seq 2664 nt   +upstreamnt  +downstreamnt
atggcgccggccgctcatcgggatggcgcggcggaggcggtggggcagagggtgttccac
ttcggcaagggccggagcgacggcaacaagaccatgaaagacctgctgggagggaagggg
gcgaacttggcggagatggcgagcatcgggctgtcggtgccgccggggttcacggtgtcg
acggaggcgtgccagcagtaccaggcgcagaaggcgatgccggcggggctgtgggacgag
atcctggcggcgctcacctgggtggagggcaacatgggcgccgtcctcggcgacccgcgc
cgcccgctcctcctctccgtccgctccggcgccgccgtctccatgcccggcatgatggac
accgtcctcaacctcggcctcaacgaccacgtcgtcgccggcctcgcccaccgcagcggc
gagcgcttcgcctacgactcctaccgccgcttcctcgacatgttcggcaacgtcgttatg
gacataccgcattcactatttgaggagaaaattgaagccatgaaagcagctttaggtttg
aggaatgacaccgagttgactgccagggatttgaaagaacttgttgctcaatataagaat
gtttatgtggaggccaaaggtgaagaatttccctcagatccaaagaagcagctgcattta
tctgtgttggctgttttcaactcatgggacagcgcaagggcaaagaagtacagaagcatt
aaccagatcactgggttaaagggtactgctgtgaatgttcagtgcatggtctttggcaac
atgggtgacacttcaggcactggtgttctctttactaggaaccctagtactggagagaga
aaactttatggtgaattccttgtcaatgctcagggtgaggatgtggttgctggaatcaga
actccacaagatcttgataccatgaaggattgcatgccagagccttatgcagaactagtt
gagaattgcaaaatcttggaaagccactacaaagaaatgatggatattgagttcactgtt
caagaaaatagactttggatgctgcaatgcagaacagggaagcgcacaggcaaaggtgct
gtgaagattgctgtagacatggtcaatgagggactgattgaccggcgttcagcaattaag
atggtggaaccacggcacttggaccagcttcttcatccccagtttgagagcccgtcgtca
tatggagacaaagttattgctacaggcttgcctgcatcaccaggagctgctgtaggccag
attgtcttcacagctgacgatgctgaagcatggcatgcacaaggaaaatctgtcattctg
gtgaggactgaaacaagcccagaggatgttggtggcatgaatgcggctgctggaattctt
acagccagaggtggtatgacatctcatgcagcagtcgtagcccgtggatggggaaaatgt
tgtgtggcaggatgctcgggtatccgtgtaaatgatgctgagaaggtggtactggttgcc
gacaaggtgctttgtgagggtgaatggttgtcactgaatggttcgactggagaggtcatt
ttgggcaagctgcctctatccccaccagcacttagtggtgatttgggagaattcatgtct
tgggtggatgaagttaagaaactcaaggtcaaggctaatgctgatactcctgcggatgca
ctgactgcaagaaataacggtgcggaagggattgggttgtgcagaacagaacacatgttc
ttctcttctgatgaaaggataaaggccatgagacagatgataatggcggaaacaattgaa
cacaggcagatagcactagatcgcctcttgccatatcagagacttgactttgaaggaatt
ttccgtgcaatggatggacttcctgtgactattcgactcttggatcctccactccacgaa
ttccttccagagggtaacgttgaggatatggttcgtttgttgtcttctggaaacgtatat
actcaggaggaaattcttacaagaatagaaaaactttctgaagtgaatccaatgcttggc
ttccgtgggtgcaggcttgggatatcatacccagaattgacagcaatgcaagcccgtgct
atctttgaagctgctatttctatgactgaacaaggtgttaaagttttcccagagataatg
gtgcctctcattggaacacctcaggaactcgcccaacaagtagatgtaattcgtgaagtt
gccgaaaaggtttttgcaaatgcagaaacaaccattagctacaaaattggatccatgatt
gaggttcccagggctgctcttatagctgatgagatagcagcactagccgaattcttctcg
tttgggacgaacgacctgactcagatgacatttggttatagcagggacgatgttggcaag
tttctgccaacctacttgtcaaagggtatcctccagaatgaccccttcgaggtgtttgac
cagaagggagtgggggagcttgttaaggttgccgtagagcggggccggaaggcaaggcct
gatttagaggtgggcatttgtggggaacatggtggtgagccttcttcagttgcatttttc
gcgaaggttgggctgaactacgtttcttgctccccattcagggttccaattgcaaggcta
gcagcagcgcaggtgatgctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338750
Entry
4338750           CDS       T01015                                 
Name
(RefSeq) pyruvate, phosphate dikinase 1, chloroplastic isoform X1
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00169  CAM (Crassulacean acid metabolism), light
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4338750
   00620 Pyruvate metabolism
    4338750
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4338750
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     4338750
SSDB
Motif
Pfam: PEP-utilizers_C PPDK_N PEP-utilizers SAM_HAT_C
Other DBs
NCBI-GeneID: 4338750
NCBI-ProteinID: XP_015639324
UniProt: Q6AVA8
LinkDB
Position
5:complement(19718508..19737701)
AA seq 947 aa
MPSVSRAVCVQRASGNNGRRCRDGAAAAGRRSVVAQRARHGKPEVAIRSGSGGSARGGHC
SPLRAVAAPIPTTKKRVFHFGKGKSEGNKAMKDLLGGKGANLAEMASIGLSVPPGFTVST
EACQQYQAAGKTLPAGLWEEIVEGLQWVEEYMAARLGDPARPLLLSVRSGAAVSMPGMMD
TVLNLGLNDEVAAGLAAKSGDRFAYDSYRRFLDMFGNVVMDIPHALFEEKLEAMKAVKGL
HNDTDLTATDLKELVAQYKDVYVEAKGEPFPSDPKKQLQLAVLAVFNSWDSPRAIKYRSI
NKITGLKGTAVNVQTMVFGNMGNTSGTGVLFTRNPSTGEKKLYGEFLVNAQGEDVVAGIR
TPEDLDAMRDHMPEPYEELVENCKILESHYKEMMDIEFTVQENRLWMLQCRTGKRTGKGA
VKIAVDMVNEGLVERRTALKMVEPGHLDQLLHPQFENPSGYKDKVIATGLPASPGAAVGQ
IVFTAEDAEAWHAQGKDVILVRTETSPEDVGGMHAAVGILTARGGMTSHAAVVARGWGKC
CVSGCSSVRVNDASKIVVIEDKALHEGEWLSLNGSTGEVIIGKQPLCPPALSGDLETFMS
WVDEVRKLKVMANADTPEDATTARQNGAEGIGLCRTEHMFFASDERIKAVRQMIMASSLE
LRQKALDRLLPYQRSDFEGIFRAMDGLPVTIRLLDPPLHEFLPEGHVEDMVRELCSETGA
AQDDVLARVEKLSEVNPMLGFRGCRLGISYPELTEMQARAIFEAAITMTNQGIQVFPEIM
VPLVGTPQELGHQVDVIRQIANKVFTDMGKTIGYKVGTMIEIPRAALVADEIAEQAEFFS
FGTNDLTQMTFGYSRDDVGKFLPIYLSQGILQHDPFEVLDQRGVGELVKLATERGRKARP
NLKVGICGEHGGEPLSVAFFAKAGLDYVSCSPFRVPIARLAAAQVLL
NT seq 2844 nt   +upstreamnt  +downstreamnt
atgccgtcggtttcgagggccgtgtgcgtgcagagggcgagcgggaataacggcaggagg
tgcagagatggggcggccgccgccggccgccgatccgtcgtggcgcagagagcgcggcac
ggcaagccggaggtcgccatccgctcggggtccggcggctcggcgcggggcgggcattgc
tcgcctctcagggcagtggcggcgccgatcccgactaccaaaaagagggtgttccacttc
ggcaagggcaagagcgagggcaacaaggccatgaaggacctgctgggagggaagggggcg
aacttggcggagatggcgagcatcgggctgtcggtgccgccggggttcacggtgtcgacg
gaggcgtgccagcagtaccaggcggcggggaagacgctgccggcggggctgtgggaggag
atcgtcgaggggctccagtgggtggaggagtacatggcggcgcgcctcggcgaccccgcc
cgccctctcctcctctccgtccgctccggcgccgccgtgtcgatgccggggatgatggac
acggtgctgaacctggggctgaacgacgaggtggcggcgggactggcggccaagagcggc
gaccgcttcgcgtacgactcctaccgccgtttcctcgacatgttcggcaacgtggtcatg
gacattcctcatgcactgttcgaggagaagctcgaagccatgaaagcagtcaaggggctg
cacaacgacactgacctgactgccactgacctcaaagaactagtggcacagtacaaggat
gtctatgttgaagctaagggagagccatttccctctgatcccaagaagcaactgcagctg
gccgtgttggccgtgttcaactcatgggatagcccaagagcaatcaagtacagaagcata
aacaagatcactgggctgaagggcactgctgtaaacgtgcagaccatggtgtttggaaac
atggggaacacctctggcacgggtgtgctcttcactaggaacccaagcactggagagaag
aagctttacggcgaattccttgtgaatgctcagggtgaagatgtggttgctggaatcaga
actccagaggatcttgatgctatgagggaccacatgccggagccttatgaagagctcgtt
gagaactgcaaaattttggagagtcactataaagaaatgatggatattgaatttactgtt
caggaaaataggctttggatgcttcagtgcagaacaggaaagcgcacaggaaaaggtgct
gtaaagattgctgtagacatggttaacgagggccttgttgagcgccgcacagcacttaag
atggtagaaccaggtcacctggatcagcttcttcatcctcagtttgagaacccatcaggg
tataaagacaaagttattgccacgggcttacctgcatcacctggggctgctgtgggccaa
attgtattcactgccgaggatgctgaagcatggcatgcccaagggaaagatgttattctg
gtgaggacagagaccagcccagaggatgttggtggcatgcatgcagctgttggaattctt
acagcaagaggtggtatgacctctcacgctgctgttgttgcgcgcggatggggcaaatgt
tgtgtgtcaggatgctcaagcgtccgtgtaaatgatgcgtccaagattgtagtgattgaa
gacaaggcgctgcatgaaggtgagtggctatcgttgaatggatcaactggtgaagtgatc
attggcaagcagccactctgcccaccagcccttagtggtgatttggaaactttcatgtct
tgggtggatgaagttaggaaactcaaggttatggcaaatgctgatacccccgaggatgca
acaacagccagacagaatggggcagaaggaattgggctatgccggactgaacatatgttc
ttcgcttcagacgagaggattaaggctgtcaggcagatgattatggcttcaagtcttgaa
ctgaggcagaaagcactagatcgccttttgccttatcagaggtctgactttgaaggcatc
ttccgtgcaatggatgggcttccggtaactattagactcttggatcctccacttcatgag
ttccttccagaaggccatgttgaggatatggtgcgtgagctatgctctgaaactggagca
gctcaggatgatgtccttgcaagagtagaaaaactttccgaagtaaatccaatgcttggt
ttccgtgggtgcaggcttggtatatcataccctgaattgactgaaatgcaagcccgtgcc
atctttgaagctgctataaccatgaccaaccagggtattcaagtctttccggagataatg
gttccccttgttggaactcctcaggaattggggcatcaagtggatgttatccgtcaaatt
gccaacaaggtgttcacagacatgggaaaaactattggctacaaagttggaactatgatt
gaaattcccagggcagctttagtggctgatgagatagcagagcaggctgagttcttctcc
tttggaacaaacgacctaacacagatgacatttggttacagtagggatgatgtggggaag
ttccttcccatctatctgtctcagggtatcctccagcatgacccctttgaggtgcttgat
cagaggggagttggggagctggttaagctggctacagagagaggccgcaaagctaggcct
aacttgaaggtgggcatctgtggtgaacatggtggagagcctctgtcagtcgctttcttt
gcgaaggctgggctggactatgtttcttgttcgcctttcagggtcccaattgctaggcta
gctgcagctcaggtgctcctctga

DBGET integrated database retrieval system