KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333306
Entry
4333306           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L13-2
  KO
K02873  large subunit ribosomal protein L13e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333306
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333306
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4333306
  Archaea
    4333306
SSDB
Motif
Pfam: Ribosomal_L13e NQRA
Other DBs
NCBI-GeneID: 4333306
NCBI-ProteinID: XP_015632652
UniProt: Q7XJB4 A3AJT4
LinkDB
Position
3:complement(21086451..21088645)
AA seq 208 aa
MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC
QTLKYNMKSRAGRGFTLEELKAAGIPKKYAPTIGISVDHRRKNRSLEGLQANVQRLKTYK
AKLVIFPRRARKVKAGDSTAEELATATQVQGDYMPIARGEKRSVEVVKVTDEMKAFKAYA
KLRVERMNQRHVGARQKRAAEAEKEEKK
NT seq 627 nt   +upstreamnt  +downstreamnt
atggtgaagcacaacaacgttatccccaatggccacttcaagaagcactggcagaactat
gtcaagacatggttcaaccagcccgcccgcaagcagaggcgccgcattgctcgccagaag
aaggctgtgaagatcttcccccgcccaacatctggccctcttcgacccattgttcagtgc
caaactttgaagtacaacatgaagtcgagggctgggagaggctttacccttgaggagctg
aaggctgcgggcatccccaagaagtatgctccaaccattggaatttccgtggatcaccgc
cgcaagaaccgctcacttgagggactccaggctaatgtccagaggctcaagacatacaag
gccaagctggttatcttcccaaggcgtgctcgcaaggtcaaggctggtgattccactgcc
gaggaacttgccactgccacccaggtccagggtgactacatgcctattgctcgtggtgag
aagcgctcagttgaggttgtgaaggtcaccgatgagatgaaggcgttcaaggcctatgct
aagctccgtgttgagaggatgaaccagcgccatgttggtgcccgccagaagagggctgct
gaggcagagaaggaagagaagaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339923
Entry
4339923           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L13-1
  KO
K02873  large subunit ribosomal protein L13e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339923
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339923
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4339923
  Archaea
    4339923
SSDB
Motif
Pfam: Ribosomal_L13e 3-HAO
Other DBs
NCBI-GeneID: 4339923
NCBI-ProteinID: XP_015644376
UniProt: Q9LWS2 A0A0P0WS58
LinkDB
Position
6:complement(867471..869885)
AA seq 208 aa
MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC
QTLKYNMKSRAGRGFTLEELKAAGIPKKFAPTIGISVDHRRKNRSLEGLQANVQRLKTYK
AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDDMKAFKAYA
KLRVERMNQRHIGARQKRAAEAEKEEKK
NT seq 627 nt   +upstreamnt  +downstreamnt
atggtgaagcacaacaacgtcatcccgaatgggcacttcaagaagcactggcagaactat
gtcaagacatggttcaaccagcccgcccgcaagcagaggcgccgcatcgctaggcaaaag
aaagctgtgaagatcttcccccgccctacttctggaccacttcgccccattgttcagtgc
caaacacttaagtacaacatgaagtctagggctggaaggggcttcacccttgaagagctg
aaggcagctgggatccccaagaagtttgccccaaccattggcatctcagtggatcaccgc
cgtaagaaccgctcacttgaaggtctgcaggccaatgtccagaggctgaagacctacaag
gccaagcttgtcatcttcccaagacgtgcccgcaaggtcaaggctggtgactcgactcct
gaggagcttgccacagccacccaggtccagggtgactacatgcctatcacccgtggcgag
aagcgctcggttgaggtcgtgaaggtcacggatgacatgaaggcattcaaggcctacgcc
aagctgcgcgtggagaggatgaaccagcgccacatcggtgcccggcagaagagggcggcc
gaggctgagaaggaagagaagaagtga

DBGET integrated database retrieval system