KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333359
Entry
4333359           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein, chloroplastic
  KO
K08913  light-harvesting complex II chlorophyll a/b binding protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4333359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4333359
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCII
    4333359
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4333359
NCBI-ProteinID: XP_015632068
UniProt: Q10HD0 I3QD65
LinkDB
Position
3:21999947..22001241
AA seq 263 aa
MAASALHQTTSFLGTAPRRDELVRRVGDSGGRITMRRTVKSAPQSIWYGPDRPKYLGPFS
EQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNG
VKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLG
EGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENL
FDHVADPVANNAWAYATNFVPGK
NT seq 792 nt   +upstreamnt  +downstreamnt
atggccgcgtcggcgctgcaccagaccaccagcttcctcggcaccgcccctcgccgggat
gagctcgtccgccgcgtcggcgactccggtggccgcatcaccatgcgccgcaccgtcaag
agcgcgccccagagcatctggtatggacctgaccgtcccaagtacctgggcccgttctcg
gagcagacgccatcgtacctgaccggagagttcccgggagactacgggtgggacacggcg
gggctatcggccgacccggagacgttcgcgaggaacagggagctggaggtgatccactcg
cggtgggcgatgctgggggcgctgggctgcgtcttcccggagatcctgtccaagaacggg
gtgaagttcggggaggcggtgtggttcaaggccggcgcgcagatcttctccgaggggggg
ctcgactacctggggaaccccaacctggtgcacgcgcagagcatcctcgccatctgggcg
gtccaggtggtgctcatgggattcgtcgagggctaccgcgtcggcggcggcccgctcggc
gagggcctcgacaaggtgtacccaggcggcgccttcgacccgctcggcctcgccgacgac
cctgacaccttcgccgagctcaaggtgaaggagctcaagaacggccgcctcgccatgttc
tccatgttcggcttcttcgtccaggccatcgtcaccggcaagggccccatcgagaacctc
ttcgaccacgtcgccgaccccgtcgccaacaacgcctgggcatacgccaccaacttcgtc
cccggcaagtga

DBGET integrated database retrieval system