KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333387
Entry
4333387           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L15
  KO
K02877  large subunit ribosomal protein L15e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333387
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333387
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4333387
  Archaea
    4333387
SSDB
Motif
Pfam: Ribosomal_L15e
Other DBs
NCBI-GeneID: 4333387
NCBI-ProteinID: XP_015632743
UniProt: Q7G6U1 Q8H8S1
LinkDB
Position
3:complement(22336663..22338400)
AA seq 204 aa
MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV
VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW
VNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHT
HHKARPSRRATWKRNQTVSLRRYR
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggtgcgtacaagtacgtgtcggagctatggaggaggaagcagtcggacgtgatgagg
ttcgtgcagcgcgtgcggtgctgggagtacaggcagcagccggccatcgtccgcctcacc
cgccccacccgccccgacaaggcccgccgcctcggctacaaggccaagcagggttatgtg
gtttaccgtgtccgtgtgaggcgtggtggcaggaagaggccagtgcccaagggtattgtc
tacggcaagcccaagcaccagggtatcacccagctcaagttccagaggaacaagaggtca
gttgctgaggagagagctgggcgcaagttgggcggactcagggtgctcaactcctactgg
gtgaacgaggactccacctacaagtactttgagatcatccttgtggatgttgctcacagt
gctatccgcaatgacccaaggatcaactggctctgcaagcctgtgcacaagcaccgtgag
ctccgtggtctcacctctgctggcaagaagtaccgtggtctgcgcggcaagggtcacact
caccacaaggccaggccgtcccgcagggctacctggaagcgcaaccagactgtctctctt
cgccgttatcgttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266562
Entry
9266562           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L15
  KO
K02877  large subunit ribosomal protein L15e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9266562
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9266562
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9266562
  Archaea
    9266562
SSDB
Motif
Pfam: Ribosomal_L15e
Other DBs
NCBI-GeneID: 9266562
NCBI-ProteinID: XP_015639399
UniProt: Q7G6U1 Q8H8S1
LinkDB
Position
5:11248146..11250231
AA seq 204 aa
MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV
VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW
VNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHT
HHKARPSRRATWKRNQTVSLRRYR
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggggcgtacaagtacgtgtcggagctatggaggaggaagcagtcggacgtgatgagg
ttcgtgcagcgcgtgcgctgctgggagtaccgccagcagccggccatcgtccgcctcacc
cgccccacccgccccgacaaggcccgccgcctcggctacaaggccaagcagggctatgtg
gtttaccgtgttcgcgtcaggcgtggtggcaggaagaggccagtgcccaagggtattgtc
tatggcaagcccaagcaccagggtattacccagctcaagttccagaggaacaagaggtca
gttgctgaggagagagctggacgcaagctgggtggactcagggtgctcaactcctactgg
gtgaatgaggactccacctacaagtactttgagatcatccttgtggatgttgctcacagc
gctatccgcaatgacccaaggatcaactggctctgcaagcctgtgcacaagcaccgtgag
ctccgtggcctcacctctgctggcaagaagtaccgtggcctgcgcggcaaaggccacact
caccacaaggccagaccttcccgcagggccacctggaagcgcaaccagaccgtctctctt
cgtcgctaccgttaa

DBGET integrated database retrieval system