KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333571
Entry
4333571           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase II subunit RPB2
  KO
K03010  DNA-directed RNA polymerase II subunit RPB2 [EC:2.7.7.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4333571
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4333571
   03400 DNA repair and recombination proteins [BR:osa03400]
    4333571
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     4333571
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     4333571
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4333571
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_2 RNA_pol_Rpb2_7 RNA_pol_Rpb2_3 RNA_pol_Rpb2_4 RNA_pol_Rpb2_5
Other DBs
NCBI-GeneID: 4333571
NCBI-ProteinID: XP_015631661
UniProt: Q10G20
LinkDB
Position
3:25033517..25042084
AA seq 1222 aa
MEDDEYEEGMEMEMGGHHHPHHGGGYGAEEYGAVGGEEMEDEEADGDAPDEEEITQEDAW
AVISAYFEEKGLVRQQLDSFDEFIQNTMQEIVDESADIEIRPESQHNPGRQAEFAETLHK
ISFGQIYLSKPMMTEADGETATLFPKSARLRNLTYSAPLYVDVSYRVMKKGHDCEEVTET
MEYPKVFIGKVPIMLRSSYCTLFQQSEKDLTELGECPYDQGGYFIINGSEKVLIAQEKMS
TNHVYVFKKRQPNKYAYVAEVRSMAENQNRPASSMFVRMLSRAGAKGGSSGQYIRATLPY
IRADIPIIIVFRALGFVADKDILEHICYDFSDTQMMELLRPSLEEAFVIQNQQVALDYIG
KRGATVGVTKEKRIKYAKEILQKEMLPHVGVGEFCETKKAYYFGYIIHRLLMCALGRRAE
DDRDHYGNKRLDLAGPLLGGLFRMLFRKLTRDVRSYVQKCVDNGKEVNLQFAIKAKTITS
GLKYSLATGNWGQANQAGTRAGVSQVLNRLTYASTLSHLRRLNSPIGREGKLAKPRQLHN
SHWGMMCPAETPEGQACGLVKNLALMVYITVGSAANPILEFLEEWGTENFEEISPAVIPQ
AAKIFVNGCWVGIHRNPDLLVKTLRRLRRQIDVNTEVGVVRDIRLKELRLYTDYGRCSRP
LFIVENQRLLIKKRHIRALQQRETPEEGWHDLVAKGFIEYIDTEEEETTMISMTINDLIG
ARHNPEEAYSETYTHCEIHPSLILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGIYVTNY
QLRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAIACYSGYNQEDSVIMNQSS
IDRGFFRSLFFRSYRDEEKKMGTLVKEEFGRPNRENTMGMRHGSYDKLDDDGLAPPGTRV
SGEDVIIGKTSPIPQDDAQGQATRYTKRDHSTSLRHSESGMVDQVLLTTNADGLRFVKVR
MRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTIEGITPDIIVNPHAIPSRMTIGQLI
ECIMGKVAAHMGKEGDATPFTDVTVDNISKALHKCGYQMRGFETMYNGHTGRKLTAMIFL
GPTYYQRLKHMVDDKIHSRGRGPVQILTRQPAEGRSRDGGLRFGEMERDCMIAHGAAFFL
KERLFDQSDAYRVHVCEKCGLIAIANLKKNSFECRGCKNKTDIVQVHIPYACKLLFQELM
AMAIAPRMLTQDNKTGKDQKKR
NT seq 3669 nt   +upstreamnt  +downstreamnt
atggaggacgacgagtacgaggaggggatggagatggagatgggcgggcaccaccacccg
caccacggcggcgggtacggcgccgaagagtacggggccgtcggcggggaggagatggag
gacgaggaggcggatggggacgcccccgacgaggaggagatcacccaggaggacgcctgg
gccgtcatctccgcctacttcgaggagaagggcctcgtgcgccagcagctcgactccttc
gacgagttcatccagaacaccatgcaggagatcgtcgacgagtccgccgacatcgagatc
cgccccgagtcgcagcacaaccccggccgccaggccgagttcgccgagacactccacaag
atcagctttggacaaatctatctgagtaaaccaatgatgacagaagctgatggagagaca
gctactttatttccaaaatcggcaaggctccgaaacctaacatactcggcgccactatat
gttgatgtatcatacagagttatgaaaaaaggacatgactgtgaagaggttacagaaact
atggagtacccaaaagtctttattggaaaggttcctatcatgttgcgttctagttattgc
acactgtttcaacagtccgaaaaggatcttacagaacttggagagtgcccttatgaccaa
ggagggtattttataatcaatggtagtgaaaaagtccttattgcccaggagaagatgagc
accaaccatgtctatgtgtttaagaagaggcagcctaataaatacgcatacgtggctgaa
gtccgttctatggcagagaaccagaatagacctgctagtagtatgtttgtgcggatgctt
tctagggcaggcgcgaaagggggttcatctggtcaatatatacgtgctactttgccttat
atccgtgcagacattccgatcatcattgtgttccgagcattaggatttgttgctgataaa
gatatattagagcacatatgctatgatttctctgatacacaaatgatggaattgctacgc
ccatctttagaggaagctttcgtcattcagaatcagcaggttgctctggattacattgga
aagcgtggagctactgttggtgtaactaaagaaaagagaattaagtatgccaaagagata
cttcaaaaagaaatgttaccccatgttggtgtgggtgaattctgtgaaaccaaaaaggcg
tactactttgggtacattattcatcgtctgctgatgtgcgctcttggtcgaagagctgaa
gatgacagagatcattatggcaacaaaagactggatcttgcaggtccattgcttggagga
ctgtttagaatgcttttcagaaagttgacaagggatgtgaggtcatatgtgcaaaagtgt
gtggataatggaaaggaagtcaatctgcaatttgctattaaagccaaaaccattactagt
gggttgaagtattcccttgctactggaaactggggacaggctaaccaagctggtaccagg
gctggtgtttctcaggtgcttaatcgccttacctatgcatctacattatctcatctgcgg
aggcttaactctccaattgggcgtgaagggaaattggcaaaacctcggcaattgcataat
tctcattggggaatgatgtgccctgctgaaacacctgagggacaagcttgtggtttggtt
aaaaatcttgcattgatggtgtatatcactgttggttctgctgcaaatcctattttggaa
tttttggaggagtggggcacagaaaattttgaggagatatcaccagccgtcattccacaa
gctgctaaaatttttgtcaacggttgttgggttggaattcacaggaaccctgacctgttg
gtgaagactcttaggcgtttgagaagacagattgatgtcaacactgaagttggtgtggtt
cgtgatattcgtcttaaagaactcagactttatacagactatgggcgttgcagtcgtcca
ctgtttattgttgaaaaccaaaggcttcttattaaaaagagacatatccgagcgttgcag
caaagggagacacctgaggaaggttggcatgacttagttgcgaaaggatttattgagtac
atagatactgaagaggaagaaactactatgatctccatgaccattaatgaccttattggt
gcaagacacaatccagaggaggcgtactctgaaacttacacacattgtgagattcatcct
tcattgatacttggtgtctgtgcctcgattattccttttccagatcataaccagtcacct
cgtaatacatatcagtctgctatgggaaaacaagcaatgggaatctatgttaccaactat
cagttaagaatggacacattggcctatgtgctatactacccacaaaagcctcttgttact
actcgtgctatggaacatttgcacttcagacagttaccagctggcattaatgcaattgtt
gctattgcatgctactctggatataatcaagaagattcggttattatgaaccaatcttca
atagatcgtggattcttccgatctctgtttttccgctcatacagagatgaggaaaagaag
atggggactcttgtcaaagaggagtttggccgtccaaatagggagaatactatgggaatg
cgtcatgggtcatatgataaactagatgatgatggacttgcaccaccaggtacaagggta
tctggtgaagatgtcattattgggaagacatctcctattccacaagatgatgcccaaggg
caagctactagatacacaaagcgtgatcacagtacttcgctgcgccacagtgaaagtggg
atggtggatcaggttctcctaacaacaaatgctgatggtttaagatttgttaaggttaga
atgcgatcagttcgtataccacagattggggataagtttagtagtaggcatggtcagaaa
ggaactgtgggaatgacttatacacaagaggacatgccatggactattgaaggcatcaca
cctgatattattgtgaatccacatgctattccatcccgtatgactattggtcaactgatt
gagtgtattatgggtaaagttgctgctcacatgggaaaagaaggagatgcaactcctttc
actgatgttactgtggataacatcagcaaagcacttcataaatgtggttatcagatgcgt
ggattcgagaccatgtacaacggtcacactggaagaaaattaactgccatgattttcctt
ggtcctacttattaccagagacttaagcacatggtggatgacaagattcactctagaggc
cgtggtcctgtgcagatacttaccagacaacctgcagaggggcgctcacgcgatggtggt
ctccggtttggagagatggagagggactgtatgattgctcatggcgctgcatttttcctt
aaggaaaggttatttgaccagagtgatgcgtacagagtccatgtatgcgagaagtgtggg
cttattgctattgctaatctcaagaagaattcctttgagtgcagagggtgcaagaacaaa
accgacattgtccaagtgcatataccctacgcgtgtaagcttctgttccaggagcttatg
gcgatggccatcgctcccaggatgctcactcaggataacaaaactgggaaggatcagaag
aaacgttga

DBGET integrated database retrieval system