KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333582
Entry
4333582           CDS       T01015                                 
Name
(RefSeq) 7-methylguanosine phosphate-specific 5'-nucleotidase A
  KO
K24242  7-methylguanosine nucleotidase [EC:3.1.3.91]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4333582
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.91  7-methylguanosine nucleotidase
     4333582
SSDB
Motif
Pfam: UMPH-1 HAD PS_pyruv_trans
Other DBs
NCBI-GeneID: 4333582
NCBI-ProteinID: XP_015631792
UniProt: Q60DI6 A0A0P0W0Q9
LinkDB
Position
3:25142507..25146180
AA seq 354 aa
MRPMTSPPLLSPSSSSSRLLLLRLLLSRRRSPASRSPPPPLRRRLPLLAASMSSSSSTAA
TRNPGSVVADADGLARKVAAIRAAGPAKLQVIADFDGTLTRYWYDGSRGQSSHGLLRQGN
EEYDAKREELFEHYHPIEICPDIPLPEKAKLMEEWWEKTHALLIEGGLTYEAIRQSVADA
KITFRDGVVKLFEFLEERDIPVLVFSAGLADIIEEVFRQKLHRSFKNIKVVSNRMVFNEE
GRLVSFKGKTIHVLNKNEHALDMAAPVHDNLGDPNGYTDDYSLVKKRTNVLLLGDHIGDL
GMSDGLNYENRIAVGFLNNNIEKSLKDYSEAFDIVYLNDAPMVGVVELVSELCP
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcggcccatgacgagcccacctctcctctcgccctcctcctcctcctcccgtctcctc
ctcctccgcctcctcctctcccgccgccggagccccgcctcgcgctcccctcctcctccc
ctccgccgccgcctccctctcctcgctgcctccatgtcctcctcctcctccaccgccgcc
accagaaaccccggctccgtcgtcgccgacgccgacggcctcgcccgcaaggtcgccgcc
atccgcgccgccggccccgctaagctccaggtcatcgcggacttcgacggcacgctcacg
cggtactggtacgacggctcccgcggccagagcagccatgggttgctgaggcaggggaac
gaggagtacgacgccaagagggaggagctgttcgagcactaccaccccatcgagatctgc
cccgacatcccgctccccgagaaggccaagctcatggaagaatggtgggagaagacacat
gctctccttatcgaaggtggacttacatatgaagctataaggcaatctgtggctgatgct
aaaatcacttttagagatggagtggtgaagctctttgagttcttggaggagagagatatt
ccagtattagtattttctgctggacttgcagacataattgaggaggtcttccggcagaaa
ctccacagatcattcaagaacattaaggttgtgtccaacaggatggtcttcaatgaagaa
ggtcgtcttgtttcatttaaaggaaagactattcatgttctaaacaaaaatgagcatgcc
ttggacatggcagctccagtgcatgacaatttgggtgatccaaatggatatactgatgac
tattcgttggtgaagaagaggaccaatgtgcttctccttggagatcacattggcgacctt
ggaatgtctgatggtctaaactatgaaaacaggattgctgttggatttctgaacaacaac
atcgagaaatctctaaaagattactccgaggcatttgatattgtctacttgaatgacgcg
ccaatggtgggagttgttgagcttgtatctgaactatgtccttaa

DBGET integrated database retrieval system