KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333598
Entry
4333598           CDS       T01015                                 
Name
(RefSeq) general negative regulator of transcription subunit 3 isoform X1
  KO
K12580  CCR4-NOT transcription complex subunit 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4333598
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4333598
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4333598
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4333598
SSDB
Motif
Pfam: Not3 NOT2_3_5 DUF5965 Peptidase_M9_N DUF5646
Other DBs
NCBI-GeneID: 4333598
NCBI-ProteinID: XP_015632313
LinkDB
Position
3:25334283..25345012
AA seq 863 aa
MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKVYDTENANQKEKFEADLKKEIKKLQRYRD
QIKTWIQSSEIKDKKVSASYEQALMDARKQIEREMERFKVCEKETKTKAFSKEGLGQQPK
TDPKEKAKAETRDWLNNVVSDLENQIDNFEAEVEGLSIKKGKQRPPRLVHLEKSITRHKA
HIKKLESILRLLDNDELSPEQVNDVKDFLDDYVERNQEDFDEFSDVEELYSTLPMEKVEA
LEDMVSLAPSSLVKGVASVSTTAVLSTKSSVATSPTQATVSAAPSLSVSQDQAEETASQE
SNPESAPQTPPSKVGSQPSVPVVPTTISTSTAAVSVSAETISSPVRPIVPTTTAAVLPAS
VTARSAPENIPAVTSAPANSSSTLKDDDNMSFPSRRSSPAVTEIGLGRGITRGLTSQGLG
SAPISIGPVSGNGSVSALTDLSKRNMLNTDERINSGGISQQLISPLGNKAQPQQVLRTTD
TISSDSSNTNESTVLGGRIFSPPVVSGVQWRPQNTAGLQNQSEAGQFCGRPEISADQREK
YLQRLQQVQQQGSLLNVSHITGISQKQFPSQQPNPLLQQFNSQSSSISSQAGIGLGQVQV
PESGHTKSEEQQQSFAEDVSVESVATAGANKHMSEDDTKIPFSNPSASITEGTQLSRDPD
LPAGQPLQPGMSSSGVGVIGRRSVSDLGAIGDNLSVASASTSHDLLYNLQMLEAAFHRLP
QPKDSERVKNYIPKHPAVTPASFPQIQAPVVSNPAFWERMGGDSLSTDLLFFAFYYQQNT
YQQFLSARELKKQSWRFHRKYNTWFQRHVEPQVTTDEYERGSYVYFDFHVIDDGTGSGWC
QRIKNDFTFEYNFLEDELSVQTN
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgggcgccagccggaagctgcagggcgagatcgaccgcgtcctcaagaaggtccaggag
ggcgtcgacgtcttcgacagcatctggaacaaggtctacgacaccgagaatgcgaaccag
aaggagaagttcgaggccgacctcaagaaggagatcaagaagctgcagcggtacagggac
cagatcaagacgtggatccagtccagcgagatcaaggacaagaaggttagtgcctcttat
gagcaggctcttatggatgcccgaaagcagattgaacgcgagatggaacgatttaaggtt
tgtgagaaggaaactaaaacgaaggccttttccaaggaagggttaggtcaacaaccgaaa
actgatccaaaagagaaggcaaaagctgaaacaagagattggcttaacaatgtggttagt
gatttggaaaaccaaatcgataacttcgaagctgaggttgaaggactttcaattaagaaa
ggaaagcaaagacctcctcgattggtacatttagagaaatctatcacacggcataaagct
cacataaagaaattggagtcaatattaagacttttggataatgatgagttgagtcctgag
caagttaatgatgtgaaagatttcctggatgactatgttgaacgtaaccaggaagatttt
gatgaatttagtgatgtggaagagctctatagcacattacctatggagaaggttgaagca
ctagaagacatggtttcacttgccccttccagtcttgtcaagggtgttgcttctgtttct
actactgcagttttgagtacgaagagttctgtagcaacttcacctactcaggctactgta
tcagcagctccttcgctaagtgtatcacaagatcaagcagaggaaacggcttcacaagaa
agcaatcctgaatcggcaccacagacaccaccttcaaaagttggaagtcaaccttcagtg
ccagtcgtgccgactaccatcagtactagtaccgctgctgtctctgtttcagctgaaacc
attagttcccctgtacgcccaattgttcctaccacaacagctgcagtacttcctgcttct
gtcactgctcgaagtgctccagagaacataccagctgttacttcagctcctgcgaactca
tctagtaccttgaaggatgatgacaacatgagctttccttcacgtagatcatcacctgca
gtcaccgaaattggccttggcaggggtattactcgtggattaactagtcagggattaggt
tcagctccaataagtataggtccagtatcagggaatggatcagttagtgcacttactgac
ttgtccaaaagaaacatgttgaatactgatgagaggattaacagtggtggtatttctcag
cagttgatttcaccacttggtaataaagctcaacctcagcaggttctgaggactactgat
acaattagctctgattctagtaacacaaatgagagtactgttcttggaggaagaatcttt
tctcccccagttgtttctggggttcaatggaggcctcaaaacactgctggtttgcaaaat
caaagtgaagcgggccaattttgtggaagacctgaaatttctgcagatcaaagggagaag
tacctgcaaagattgcagcaagtacaacaacaaggcagccttcttaatgtttctcatata
acgggcataagtcagaagcaatttccatcacaacaaccaaacccgctcttacaacagttt
aactctcagagttcctctatttcctcccaagcgggtattgggcttgggcaggtacaagta
ccagaatctgggcatacaaaaagtgaggaacaacaacaaagttttgcagaagatgttagt
gtggaatccgttgcaacagctggagcaaacaaacacatgagtgaagatgatacaaagatt
ccattttcgaatccgtcagcatccataacagaaggtactcaactatctagagaccctgat
ctaccagctgggcagcctttgcaacctggcatgtcatcatctggtgttggtgttatcggc
cggaggagtgtatctgatcttggtgcaattggtgataacctcagtgtagcttctgcaagt
actagtcatgatctgctttataatctgcaaatgcttgaagctgctttccataggcttcca
caaccaaaggactcggagcgagtcaaaaattatattccgaagcaccctgcagtcacccct
gccagcttcccgcaaattcaggcacctgtagtatcaaatcctgccttttgggaaagaatg
ggtggcgattcattatctacggatttgttgttctttgctttctactatcagcaaaacaca
taccagcaatttttaagtgccagagaactaaagaagcaatcgtggagatttcacagaaag
tacaatacttggttccaacggcacgtggagccacaagttacaactgatgagtatgagcgg
ggatcttatgtgtactttgatttccatgtcatagatgacggcacaggatcaggatggtgt
cagagaatcaagaacgacttcacatttgagtacaacttccttgaggatgagctgtcagta
cagacaaattag

DBGET integrated database retrieval system