KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333608
Entry
4333608           CDS       T01015                                 
Name
(RefSeq) membrin-11
  KO
K08496  golgi SNAP receptor complex member 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4333608
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4333608
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[N] (Qb)
   Bos1 / Membrin
    4333608
SSDB
Motif
Pfam: V-SNARE_C Sec20 SpoVR Fmp27_WPPW Zeta_toxin Mononeg_mRNAcap FUSC MbeD_MobD
Other DBs
NCBI-GeneID: 4333608
NCBI-ProteinID: XP_015633085
UniProt: A0A0P0W0U6 Q6AT61
LinkDB
Position
3:complement(25552421..25556508)
AA seq 244 aa
MDFSGGGGGGGGATLSEMYQSARRLLLSARDGVARVERLASAPTSSSYSSAPLVGGGGGA
GDSAAAEEVRREVAQIQGLCAQMDRLWRSIPAKGQRDLWKRKVEQLSEEVDSLKETLDRH
SLRQKKRVLEAKERAELFERANGESSHVLRIFDDEAQAMQSARSSSRMLDEAYETGVAIL
HKYADQRDRLKSAQRKALDILNTVGLSNSVLKLIERRHRVDKWIAYAGMMITVVVMFVFW
RWTH
NT seq 735 nt   +upstreamnt  +downstreamnt
atggatttctccggcggcggaggcggcggcggcggcgcgacgctgtcggagatgtaccag
agcgcgcggcggctgctgctctcggcccgggacggcgtggcccgcgtcgagcgcctcgcg
tcggcgcccacctcgtcttcctactcctcggcgccgctcgtcgggggcggcggcggtgcc
ggggattcggcagccgccgaggaggtgcggcgggaggtggcccagatccaggggctgtgc
gcgcagatggaccggctctggcgatccatccccgccaagggccagcgtgatctctggaag
agaaaagtggagcagttgtctgaagaggttgattcgctaaaggaaacccttgacagacat
tctctgcggcaaaaaaagagggttctagaagcaaaagaaagggcagagctatttgagaga
gctaatggtgagtcttcacatgtccttcggatatttgatgatgaagcccaggcaatgcaa
tcagctcgtagctcctctcgtatgcttgatgaagcatatgaaacaggagtagctatcctt
cacaagtatgctgaccagagggatcgtctaaagagtgctcaaaggaaagcgttggatatt
ctgaacaccgttggtctatcaaattctgttttgaagcttattgagaggcggcaccgtgtg
gacaagtggattgcatatgctggtatgatgatcacagtggtggtgatgtttgtgttttgg
cggtggacgcattag

DBGET integrated database retrieval system