KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333679
Entry
4333679           CDS       T01015                                 
Name
(RefSeq) deoxyuridine 5'-triphosphate nucleotidohydrolase
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Module
osa_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4333679
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4333679
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     4333679
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    4333679
 Prokaryotic type
    4333679
SSDB
Motif
Pfam: dUTPase
Other DBs
NCBI-GeneID: 4333679
NCBI-ProteinID: XP_015628906
UniProt: Q10FF9
LinkDB
Position
3:complement(26396355..26397480)
AA seq 225 aa
MAGKLGAICSRLISPLFNHHCRLRRFPQIHSPPPPFVPFSRHHRLPPRALSAVAMATATN
GNASAAAAAADSAVQEPPHKIAKVAPLLKVKKLSENAVLPSRGSALAAGYDLSSAAEVVV
PARGKAMVPTDLSIAIPEGTYARVAPRSGLALKHSIDVGAGVIDADYRGPVGVILFNHSD
TDFAVKPGDRIAQMIIEVIVTPEVAEVEDLDATVRGEGGFGSTGV
NT seq 678 nt   +upstreamnt  +downstreamnt
atggcgggaaaacttggcgccatctgttcccgcctcatctcccctctatttaaccaccat
tgccgcctccgccgcttcccccaaatccactcacctcctccaccgttcgtccccttctcg
cgccaccaccgcctgccgccgagagctctctcagccgtcgccatggccaccgctaccaac
ggcaacgcctccgccgccgccgccgccgctgactccgccgtccaggagcccccgcacaag
atcgccaaggttgctcccttgctcaaggtcaagaagctctccgagaacgccgtcctgccg
tcccgcggctccgccctcgccgccggctacgacctgtcgagcgcggcggaggtcgtcgtg
ccggcgagggggaaggcgatggtgccgacggacctcagcatcgccatcccggagggcacc
tacgcgcgcgtcgcgccgaggtctgggctggcgttgaagcactcgatcgacgtaggcgcc
ggggtgatcgacgccgactaccgtggcccggtaggggtcatcctcttcaaccactccgac
accgacttcgccgtgaagcccggcgaccggatcgcgcagatgatcatcgaggtgatcgtg
acgccggaggtcgccgaggtggaggacctcgacgccaccgtcaggggagagggagggttc
ggatccaccggcgtctga

DBGET integrated database retrieval system