KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333719
Entry
4333719           CDS       T01015                                 
Name
(RefSeq) phosphomethylpyrimidine synthase, chloroplastic
  KO
K03147  phosphomethylpyrimidine synthase [EC:4.1.99.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00897  Thiamine biosynthesis, plants, AIR (+ NAD+) => TMP/thiamine/TPP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4333719
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.17  phosphomethylpyrimidine synthase
     4333719
SSDB
Motif
Pfam: ThiC_Rad_SAM ThiC-associated
Other DBs
NCBI-GeneID: 4333719
NCBI-ProteinID: XP_015632971
UniProt: Q10F62 Q0DPM7
LinkDB
Position
3:26952005..26958989
AA seq 639 aa
MAALQPSFSSAMAMKSLKLPKTAVLPGFGGIARPQDVQDRSANFTCSRPRAASVTDQSTA
EPAKPRQNKHTVDPSAPEFLPLPSFEECFPRSTKESREIVHEESGHVLKIPFRRIHLTGD
EKHFDTYDTSGPQNISPRIGLPKIRKEWIDRREKLGGPRYTQMYYAKQGIITEEMLYCAT
RENLSPEFVRSEVARGRAIIPSNKRHLELEPMIVGRNFLVKVNANIGNSAVVSSIEEEVH
KLQWATMWGADTVMDLSTGRHIHETREWILRNSSVPIGTVPIYQALEKVNGIAENLSWEV
FRDTLIEQAEQGVDYFTIHAGVLLRYIPLTAKRMTGIVSRGGSIHAKWCLTYHKENFAYE
HWDEILDICNQYDVALSIGDGLRPGSIYDANDSAQFAELLTQGELTRRAWAKDVQVMNEG
PGHIPMHKIPENMEKQLEWCNEAPFYTLGPLTTDIAPGYDHITSAIGAANIGALGTALLC
YVTPKEHLGLPNRDDVKTGVISYKISAHAADLAKGHPYAQAWDDTLSKARFEFRWLDQFA
LSLDPVTAMSFHDETLPSEGAKVAHFCSMCGPKFCSMKITEDIRKYADEHGYGTVEEAVI
QGMNAMSAEFSAARKTISGEQHGEAGGEIYVPESYTARK
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggctgccctgcaaccctcattctcttcagcaatggctatgaaaagtctgaagttaccc
aaaactgcagttttacctggatttggtggtattgcacgtcctcaagatgtgcaggacagg
agcgctaacttcacttgttcaaggcctagagcagcttcagtgactgaccagtcaacagca
gagccagcaaaacccaggcaaaacaagcacactgttgatccttctgctccagaatttctg
ccactcccatcatttgaagaatgctttccaaggagcacaaaagaatccagagaaattgtg
cacgaggaatctggccatgtcctcaagatcccatttaggagaatccatttgaccggagat
gagaagcattttgacacatacgacaccagtggtccacaaaacattagtccaaggattgga
cttccaaagataaggaaggaatggattgacaggagggagaagttaggtggtcctcgatac
acacaaatgtattacgctaagcagggaatcataacagaggagatgttgtactgtgccaca
cgtgagaaccttagtcctgaatttgtccggtcagaggttgcccgtggacgagctataatt
ccttccaacaagaggcacctggaattggaacccatgattgttggacgaaacttccttgta
aaagtgaatgcaaacattgggaattctgctgttgtgagctccatcgaggaggaagtacac
aagctccagtgggctacaatgtggggagctgatactgtcatggacctttcaacagggcgt
catatccatgagacccgggaatggatccttcgtaattcttcagtccctattgggacggtg
cctatttaccaagcacttgagaaagttaatggtattgctgaaaatctaagctgggaagtc
tttagagatactttaatcgaacaagctgagcagggtgttgattacttcacaatccatgct
ggcgtgcttcttcgttacattcctcttacggcaaagagaatgaccggcatagtttcacgt
ggtggctctatccatgcaaaatggtgcctaacatatcataaggagaactttgcctatgag
cactgggatgaaattcttgatatttgcaatcagtatgatgtggcattatccattggcgat
ggtttgagaccaggttctatttatgatgcaaatgatagtgctcagtttgcagaattgctg
actcaaggggaactcacacgccgagcttgggcaaaagatgtgcaggtaatgaatgaaggc
ccagggcacattccgatgcataaaattcctgaaaacatggagaagcaactggagtggtgc
aatgaagcacctttctacacactggggccactgacaactgatattgcacctggttatgat
cacatcacctccgccattggtgctgccaacattggggctcttggcactgcacttctctgt
tatgtaacaccaaaggagcaccttggattgcctaaccgtgatgatgttaagacaggcgtg
atatcctacaaaatttctgctcatgctgctgatttggcaaagggccatccctatgcacaa
gcatgggacgatacactaagcaaggcaagatttgagtttagatggttggatcaatttgct
ctatctctggatcctgtgaccgctatgtctttccatgatgaaacattaccatcggagggt
gccaaagtggcacatttctgctcaatgtgtggcccaaagttttgttcgatgaaaatcaca
gaggatattagaaaatatgctgatgaacatggttacgggacagtggaggaagcggtgata
caaggaatgaatgctatgagtgctgagttttcagctgcaaggaaaacaatcagtggggag
caacatggtgaagctggaggggagatatatgttccagaaagctatacagctcgcaaataa

DBGET integrated database retrieval system