KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333811
Entry
4333811           CDS       T01015                                 
Name
(RefSeq) alkaline ceramidase 3
  KO
K04711  dihydroceramidase [EC:3.5.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4333811
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-
     4333811
SSDB
Motif
Pfam: Ceramidase
Other DBs
NCBI-GeneID: 4333811
NCBI-ProteinID: XP_015632788
UniProt: A3ALR1 Q84LH5
LinkDB
Position
3:complement(28014986..28018893)
AA seq 257 aa
MADSMVSSFWGPVTSTTELCEENYAHSSYIAEFYNTVSNVPCVLLALVGLVNALRQGFEK
RFSVLHISNMILAIGSMIFHATLQHVLQQSDETPMVWEILLYLYVLYSPDWHYRSTMPTF
LFLYGAAFAVVHFLVRFQVVFKLHYVGLCLLCIPRMYKYYIQTKDMAAKRLAKLWVLTLS
LATLCWLFDRMFCKKLSHWYVNPQGHAWWHILMGFNSYFANTFLMFCRAQQRGWEPKITH
LFGFLPYVKIQKPQKRE
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcggattctatggtgtcaagtttctgggggcctgttacttcaacaactgagctctgc
gaggaaaattatgcacactcgtcatatattgcagaattctacaatactgtttctaatgtt
ccatgtgttcttctggcacttgttggacttgtgaatgctcttcgccaaggttttgagaaa
cgattcagtgtcctgcacatatccaatatgatacttgctatcggcagtatgatcttccat
gccaccttacagcacgttttacagcagagcgatgagactccaatggtgtgggagattctc
ctatatctttatgtactttattcaccagactggcattaccggagcactatgcctactttc
cttttcctatacggtgctgcttttgcagtagtccatttcctggtgcgattccaagtggta
ttcaagttgcattacgttggcctctgtctcctatgcatcccacggatgtacaagtactac
atacaaactaaagacatggctgccaagcgtctagcaaagctgtgggttcttacgttgagc
ttggcgactctttgctggctatttgatcgaatgttctgtaagaagctttcacattggtac
gtcaacccacaagggcacgcatggtggcatattctcatgggatttaactcatactttgca
aacacattcttaatgttttgccgagctcaacagcgtgggtgggagcccaaaattacccac
cttttcgggttcttgccttatgtcaagattcagaaaccccaaaagagggaatga

DBGET integrated database retrieval system