KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333826
Entry
4333826           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor 18 isoform X1
  KO
K12817  pre-mRNA-splicing factor 18
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4333826
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4333826
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Step II factors
    4333826
SSDB
Motif
Pfam: Prp18 PRP4
Other DBs
NCBI-GeneID: 4333826
NCBI-ProteinID: XP_015628827
UniProt: Q53RB6 Q10EE8
LinkDB
Position
3:complement(28138879..28141960)
AA seq 501 aa
MERVFSTRQIRRKHCLYGLCFALKFALSRPKVKLGQSPTGLLFTQSELRKSRFEKVRARN
LSCSMLPEPIDLPKTNAQKLSIHPPIRHAEPPIRLSKIQSKANPLCECATATHPHSGEPM
DVLKRELQRKRQLLDADFGGRKLLRRAEIERREMERIREAERRLLLQKQLRSSSSHHRAA
SRSTTTPGAPDGDESSRTEHRGDGEEKEGAPLLPREEVIRRLRVLRQPATLFGEDDAARL
RRLHAVLEDPAALADVEAAEIGEGQTNDFLRDIQALRAKAVAASASAAAKPKAGAATAES
GGETREEVPFEELCDEDKIMTFFKRLMSEWSQEMDEMPEAERRTAKGKAAVATCKQCARY
LEPLFKLCKKKTLPEDVRGSLLEVVRCCMRRDYLAAVDNYIKLAIGNSPWPIGVTMVGIH
ERSAREKIYANSVAHIMNDETTRKYLQSVKRLMTFCQRKYPTDPSRSVEFNSLANGSDLQ
SLLAEQNSKNSEETLRLVAAS
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggagagagtattttccacacggcaaatacggagaaaacactgtttgtatgggctttgc
tttgcgcttaagtttgcacttagcaggcctaaagttaaactgggccaatcacctaccggt
ttactcttcactcaatccgaactccgaaaatcgagattcgagaaggttcgcgcgagaaac
ctttcgtgctcgatgcttccagaacccatcgatctcccaaaaacgaatgctcaaaaacta
tccatccatcctccgatccgccatgcggaacctccgattcgcctctccaaaatccaaagc
aaagctaacccactctgcgagtgcgccaccgcgacccacccccactccggcgagccaatg
gacgtcctgaagcgcgagctacagcggaagcgccagctgctcgacgccgacttcggcggc
cgcaagctcctccgccgcgccgagatcgagcgccgcgagatggagcggatccgggaggcc
gagcgccggctcctcctccagaagcagctccggtcctcctcctcccaccaccgcgccgcg
tcgcgctccacgaccacgccgggggctcccgacggcgacgagtcgtcgcggaccgagcac
cgcggcgacggggaggagaaggagggcgcgccgctcctccccagggaggaggtcatccgg
cgcctgcgcgtgctgcgccagccggccacgctcttcggcgaggacgacgccgcgcgcctc
cgccgcctccacgccgtgctcgaggaccccgcggcgctcgccgacgtcgaagcggcggag
atcggggagggccagaccaacgacttcctccgcgacatccaggcgctgcgggcgaaggcc
gttgcggcgtcggcgtcggcggcggcgaagcccaaggctggcgctgcaactgcagagagc
gggggcgagacgagggaggaggtgccgttcgaggagctctgcgacgaggacaagatcatg
accttcttcaagaggctgatgagcgagtggagccaggagatggacgagatgcccgaggcg
gagaggcggacggcgaaagggaaggctgcggtggccacctgcaagcagtgcgcgcgctat
ctcgagccgctgttcaagctgtgcaagaagaagaccctgcccgaagatgtccgtggatca
ttgctggaggtggtgaggtgctgcatgagacgggactacttggcggcggtggacaactac
atcaagctcgccatcggcaactcgccgtggccgatcggcgtcacgatggtgggcatccac
gagcgctcggcgcgcgagaagatctacgccaacagcgtggcgcacatcatgaacgacgag
acgaccaggaagtacctgcagtccgtgaagaggctgatgaccttctgccagaggaagtac
ccgacggacccgtccaggtcggtggagttcaacagcctggccaacggcagcgacctgcag
tccctcctggcggagcagaactccaagaactcggaggagacgcttcggctggtggccgcg
tcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343671
Entry
4343671           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor 18
  KO
K12817  pre-mRNA-splicing factor 18
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4343671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4343671
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Step II factors
    4343671
SSDB
Motif
Pfam: Prp18 PRP4
Other DBs
NCBI-GeneID: 4343671
NCBI-ProteinID: XP_015647118
UniProt: A0A0N7KNQ1 Q6YTU8
LinkDB
Position
7:complement(23087858..23090916)
AA seq 438 aa
MDLLKRELEKKRKAATADFGGKSFVRRSELEQKQLQKRRHEEHRQLLSKAPPATSSASAA
GSDPSNPNADPAQSSAANPNPNSSSSAAAASVPPGLAGKKTAQDEALLSEERRIDELDLP
RHEVVRRLRILREPVTLFGEDDADRLARLKFVLKSGVIDDIDDLDMTEGQTNDFLRDMVE
LRKRQRAGRDTYVKGKGKRAGGGDGGEGGAGGDNADDGDGDGRRSGDDADADKDSKRMKT
KFEELCDEDKILVFFKKLLIEWNQELDEMPELEKRTAKGKSMVATFKQCARYLSPLFEFC
RKQVLPDDIRQALLVIVECCMKRDYLAAMDQYIKLAIGNAPWPIGVTMVGIHERSAREKI
YTNSVAHIMNDETTRKYLQSIKRLMTLCQRRYPALPSKSVEFNSLANGSDLQALLSEEKD
PGNPPSEDRLRLMPASKE
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggatcttctgaagagggagctggagaagaagcggaaggcggcgacggccgacttcggc
gggaagagcttcgtgcggcggtcggagctggagcagaagcagctccagaagcggcgccac
gaggagcaccgccagctcctctccaaggccccgccggcgacctcctccgcctccgccgcg
ggctccgaccccagcaaccccaacgccgacccggcccagtcctccgccgcaaaccctaac
cctaactcctcctcgtccgccgccgccgcgtccgtcccgccgggcctcgcggggaagaag
accgcgcaggatgaggcgctcctctccgaggagcgccggatcgacgagctcgacctcccg
cggcatgaggtggtgcggcgcctccgcatcctgcgcgagcccgtcacgctgttcggggag
gacgacgccgaccggctcgcccgcctcaagttcgtgctcaagtccggcgtgattgacgac
atcgacgaccttgacatgacagaggggcagacgaacgacttcctccgtgacatggtcgag
ctccgcaagcggcagagggctggccgggacacctatgtcaagggcaagggcaaacgagcg
ggcggcggtgatggcggcgagggtggcgctggcggggataatgctgatgatggggatggg
gacggccggaggagtggggatgatgctgatgcggacaaggactcgaaacggatgaagacc
aagtttgaggagctgtgtgatgaggacaagatcttggtgttcttcaagaagctactcatt
gagtggaaccaggagcttgatgagatgccggagctggagaagaggacagcaaagggcaag
tcgatggtcgcaaccttcaagcaatgtgcgcggtatctcagccccctgtttgagttttgc
aggaagcaggttcttcctgatgacatccgtcaagcattgctcgttattgttgaatgctgc
atgaagcgtgattatttagcagcaatggaccaatacatcaagctggccattggcaatgca
ccatggcctattggtgtcactatggttggtatccacgagcgttcggcccgagaaaagatc
tacacaaacagtgtggcgcacattatgaacgatgagaccactcgcaagtaccttcagtca
atcaagaggcttatgaccctttgccagcgacgttatcctgctctgccctcaaaatcggtg
gagttcaacagcctggcaaatgggagtgacctgcaggcccttttgtcagaggagaaagat
ccaggaaaccctcctagcgaggataggcttcgactcatgccagcgtcaaaagagtga

DBGET integrated database retrieval system