KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333888
Entry
4333888           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase I subunit RPA12
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4333888
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4333888
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     4333888
SSDB
Motif
Pfam: TFIIS_C RUBY_RBDX DZR HypA DUF4914 Zn-ribbon_8 DUF3716 C1_1
Other DBs
NCBI-GeneID: 4333888
NCBI-ProteinID: XP_015633171
UniProt: Q9AUR4 A0A0P0W2J4
LinkDB
Position
3:28746625..28748727
AA seq 126 aa
MAFWQARDFLFCGVCGTLLKFDSVRSASCPLCGFKRKAKDIEGKETRYTVTAEDIRRELK
LDPYVILETTLKEEDVIVERATVNKECEKCKNPELQYYTKQLRSADEGQTVFYKCANCRH
EFNENQ
NT seq 381 nt   +upstreamnt  +downstreamnt
atggccttctggcaggcgcgggacttcctcttctgcggcgtgtgcggcaccctcctcaaa
ttcgactccgtccgctccgcctcctgccccctctgcggcttcaagcgcaaggccaaagat
atcgaagggaaggagacgcggtacacggtcacggctgaggatattagaagagagctaaaa
cttgatccatatgtgattcttgaaacaacactgaaggaggaagacgtaattgtcgaaaga
gctacagtaaataaagagtgtgaaaaatgcaaaaatcctgaacttcagtattacaccaag
cagttacggtcagcagatgaggggcaaactgttttctataagtgcgcaaactgcaggcat
gagttcaatgagaaccagtag

DBGET integrated database retrieval system