KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333895
Entry
4333895           CDS       T01015                                 
Name
(RefSeq) phosphoglucomutase, cytoplasmic 2
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00052  Galactose metabolism
osa00230  Purine metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4333895
   00030 Pentose phosphate pathway
    4333895
   00052 Galactose metabolism
    4333895
   00500 Starch and sucrose metabolism
    4333895
   00520 Amino sugar and nucleotide sugar metabolism
    4333895
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4333895
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     4333895
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-GeneID: 4333895
NCBI-ProteinID: XP_015632142
UniProt: A0A0P0W2Q2 Q9AUQ4
LinkDB
Position
3:28813586..28820090
AA seq 582 aa
MVLFSVTKKATTPFDGQKPGTSGLRKKVTVFQQPHYLQNFVQSTFNALPADKVKGATIVV
SGDGRYFSKDAVQIITKMAAANGVRRVWVGQNSLMSTPAVSAVIRERVGADGSKATGAFI
LTASHNPGGPTEDFGIKYNMENGGPAPESVTDKIFSNTTTITEYLIAEDLPDVDISVVGV
TTFSGPEGPFDVDVFDSTIDYIKLMKTIFDFESIKKLLASPKFTFCYDALHGVAGTYATR
IFVEELGAAESSLLNCVPKEDFGGGHPDPNLTYAKELVDRMGLGKSSNAEPPEFGAAADG
DADRNMILGKRFFVTPSDSVAIIAANAVQSIPYFSSGLKGVARSMPTSAALDVVAKNLNL
KFFEVPTGWKFFGNLMDAGMCSICGEESFGTGSDHIREKDGIWAVLAWLSILAFKNKDNL
GGDKLVTVEDIVRQHWGTYGRHYYTRYDYENVDAGAAKELMANLVSMQSSLSDVNKLIKE
IRSDVSDVVAADEFEYKDPVDGSVSKHQGVRYLFGDGSRLVFRLSGTGSVGATIRVYIEQ
YEKDSSKTGRDSQDALAPLVDVALKLSKMQEYTGRSAPTVIT
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggtgctgttctcggtgacgaagaaggccaccacgcccttcgacggccagaagcccggc
acctccggcctccgcaagaaggttactgtattccagcagcctcattacctccagaacttt
gtgcaatccacatttaatgcccttcctgccgacaaagtaaaaggtgcaaccattgttgtg
tctggtgatggccgctatttctcgaaggatgctgttcagatcattacaaaaatggctgcc
gctaatggagtaagacgtgtttgggttggacaaaacagcctcatgtctactccagctgta
tctgctgttatccgtgaaagagttggtgcagatggatcaaaggctactggtgccttcatt
ttaacagctagtcacaaccctggtggtcctactgaggacttcggaatcaaatataacatg
gaaaatggtggacctgcccctgaatcggttactgataagatcttctctaatacaacgaca
attactgaatatctcatcgcggaagaccttccagatgtcgatatttctgttgtaggtgtc
actaccttcagtggacctgaaggcccttttgatgttgatgtttttgactctactatagat
tacataaagttaatgaagacaatctttgactttgagtcaattaaaaagcttctggcatct
ccgaagtttacattctgttatgatgctctccatggtgttgctgggacttacgcaacacgc
atctttgtggaagagcttggtgctgctgaaagctcattgttgaactgtgttccgaaggaa
gactttggagggggccatccagatcctaacctcacctatgcaaaagaacttgttgaccgg
atgggccttggaaaatcctcaaatgctgaacccccagaatttggtgctgcagctgatggt
gatgctgatcgcaacatgattctgggtaaaagattcttcgtaacaccttcagattcggtt
gccattattgcagccaatgctgttcagtcgattccttacttttcttctggccttaaggga
gttgccaggagcatgcccacatcagctgcccttgatgttgtcgctaagaatttgaatctc
aagttctttgaggtgcctactgggtggaaattttttgggaacttgatggatgctggaatg
tgctcaatttgtggtgaagaaagctttggcactggttctgatcacattcgtgagaaagat
ggtatttgggctgttctagcatggttatctattcttgctttcaagaacaaggacaacctt
ggaggcgataagcttgttactgttgaagatattgttcgccagcactggggtacttatggt
cgccattattatacacgatatgactatgagaatgttgatgctggagctgctaaagaactt
atggcaaaccttgtcagcatgcagtcgtccctttctgatgttaacaaattgatcaaggag
attcggtcagatgtttctgatgtggttgccgcagatgagtttgagtataaggatcctgtt
gatggttctgtctccaagcatcagggtgtccggtacctcttcggagatggttcccggctg
gtgttccgcctctctggaactggctctgttggtgctactatccgtgtctacatcgagcag
tatgagaaggattcttccaagaccggcagggattcgcaggatgcccttgctcctctggtt
gatgttgcactgaagctgtcaaagatgcaagagtacactggccgatctgctcccaccgtc
atcacataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348230
Entry
4348230           CDS       T01015                                 
Name
(RefSeq) phosphoglucomutase, chloroplastic
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00052  Galactose metabolism
osa00230  Purine metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4348230
   00030 Pentose phosphate pathway
    4348230
   00052 Galactose metabolism
    4348230
   00500 Starch and sucrose metabolism
    4348230
   00520 Amino sugar and nucleotide sugar metabolism
    4348230
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4348230
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     4348230
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-GeneID: 4348230
NCBI-ProteinID: XP_015614961
UniProt: A0A8J8YD12 Q33AE4
LinkDB
Position
10:complement(6167113..6174627)
AA seq 609 aa
MASHALRLHPLLFSAAAARPAPLAARPGGGARRVHRRHSLAVVRCSSSAAQALKIKSIPT
KPVEGQKTGTSGLRKKVKVFQQENYLANWIQALFNSLPPEDYVGGTLVLGGDGRYFNKDA
AQIITKIAAGNGVGKILVGRNGLLSTPAVSAVIRKRQANGGFIMSASHNPGGPDNDWGIK
FNYSSGQPAPETITDQIYGNTLSISEIKTADIPDVDLSSLGVVSYGDFTVEVIDPVLDYL
ELMENVFDFQLIKGLLSRPDFRFVFDAMHAVTGAYADPIFVEKLGADPDYILNGVPLEDF
GNGHPDPNLTYAKELVFTMFGSGAPDFGAASDGDGDRNMILGRRFFVTPSDSVAIIAANA
QAAIPYFQSGPKGLARSMPTSGALDRVADKLNVPFFEVPTGWKFFGNLMDAGKLSICGEE
SFGTGSDHIREKDGIWAVLAWLSILAHRNKDKKAGERLVSVEDVAREHWATYGRNFFSRY
DYEECESESANKMMEHLRDVIAKSKPGEKYGNYTLQFADDFSYTDPVDGSTVSKQGLRFV
FTDGSRIIFRLSGTGSAGATIRIYIEQFESDASKHDLDAQIALKPLIDLALSVSKLKDFT
GRDKPTVIT
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggcctcgcacgcgctccgcctccacccgctgctcttctccgccgccgccgcgcgcccg
gctccgctcgcggcgcggcccggtggtggtgcccgccgggtccaccgccgccactctctc
gccgtcgtccggtgctcctcctccgccgcccaggcgctcaagatcaagtcgattccgacc
aagcccgttgaggggcagaagaccgggaccagtgggttgaggaagaaggtgaaagtgttc
cagcaggagaattacctcgctaattggattcaggctctgttcaattcattgcccccggag
gattatgttggtggaacccttgtgcttggtggtgatggccgatactttaacaaggatgct
gctcagattatcactaaaattgcagctgggaatggtgttgggaagatcctagttggcagg
aacggtctgctgtcaacgcctgctgtatctgcagtaattcgtaaaagacaagccaatggt
ggcttcatcatgagtgcaagccataatccaggtgggccagataatgattggggtatcaag
ttcaactatagcagtgggcagccagcaccagagacaattaccgaccaaatatatggaaac
acactttcgatttctgaaataaaaacggcagatattcctgatgttgatttgtcctctcta
ggagttgtaagctatggtgatttcaccgttgaagtgatagaccctgtcttggactacctt
gagctaatggagaatgtgtttgacttccaacttatcaagggcttgttgtctcggccagat
ttcaggtttgtatttgatgccatgcatgctgtgactggtgcatatgcggatcctattttt
gttgagaaacttggagctgatccggactatatattaaatggtgttccacttgaagatttt
ggcaatggtcaccctgatcctaatttaacttatgccaaagagcttgtgtttaccatgttt
ggaagcggagcacctgactttggtgcagcaagtgatggtgatggtgatcgaaacatgatt
cttggaagaaggttctttgttacaccatcagactctgttgcaataattgcagcgaatgca
caggcagcaattccttatttccaatctggtccaaaaggtcttgctagatcaatgccaacg
agtggtgctcttgatcgtgtagctgataaattgaatgttccgttctttgaggtaccaaca
ggatggaaattttttggaaacctaatggatgcaggtaaattgtctatatgtggagaggaa
agttttgggacaggatctgatcacatcagggagaaggatggcatatgggctgttctagct
tggctgtccatacttgcacaccggaacaaggataagaaggccggggagagattagtgtca
gtggaagatgtagctagggaacactgggcaacctatggaaggaatttcttctccagatat
gattatgaggagtgtgaatctgagagtgcaaataagatgatggagcatcttagagatgtg
atcgcaaaaagcaagcctggagagaaatatggaaactatacccttcagtttgccgatgat
ttcagttacactgatccggtggatggtagcactgtatctaaacaagggcttcgatttgta
ttcaccgatggatctaggattatcttccgcctttcgggaaccggatctgctggagcaaca
atccgtatatacattgagcaattcgagtctgatgcctcaaagcatgatctggatgcacaa
atagctttgaagcctttaatagacctagctctatctgtttcaaagttgaaggacttcact
ggaagagataagcctactgtcataacataa

DBGET integrated database retrieval system