KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333930
Entry
4333930           CDS       T01015                                 
Name
(RefSeq) phytochrome A
  KO
K12120  phytochrome A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4333930
SSDB
Motif
Pfam: PHY PAS PAS_2 GAF HATPase_c PAS_9 HisKA PAS_4 PAS_8 PAS_10 Tab2-like_N
Other DBs
NCBI-GeneID: 4333930
NCBI-ProteinID: XP_015630340
UniProt: Q10DU0
LinkDB
Position
3:complement(29168187..29176107)
AA seq 1128 aa
MSSSRPTQCSSSSSRTRQSSRARILAQTTLDAELNAEYEEYGDSFDYSKLVEAQRTTGPE
QQARSEKVIAYLHHIQRAKLIQPFGCLLALDEKTFNVIALSENAPEMLTTVSHAVPSVDD
PPKLRIGTNVWSLFTDPGATALQKALGFADVSLLNPILVQCKTSGKPFYAIVHRATGCLV
VDFEPVKPTEFPATAAGALQSYKLAAKAISKIQSLPGGSMEVLCNTVVKELFDLTGYDRV
MAYKFHEDDHGEVFAEITKPGLEPYLGLHYPATDIPQAARFLFMKNKVRMICDCRARSIK
IIEDESLHLDISLCGSTLRAPHSCHLQYMENMNSIASLVMAVVVNENEDDDEVGADQPAQ
QQKRKKLWGLLVCHHESPRYVPFPLRYACEFLAQVFAVHVNKEFELERQVREKSILRMQT
MLSDMLLRESSPLSIVSGTPNIMDLVKCDGAALLYGGKVWRLQNAPTESQIRDIAFWLSD
VHRDSTGLSTDSLHDAGYPGAAALGDMICGMAVAKINSKDILFWFRSHTAAEIRWGGAKH
DPSDKDDSRRMHPRLSFKAFLEVVKMKSLPWNDYEMDAIHSLQLILRGTLNDDIKPTRAA
SLDNQVGDLKLDGLAELQAVTSEMVRLMETATVPILAVDSNGLVNGWNQKVAELTGLRVD
EAIGRHILTVVEESSVPVVQRMLYLALQGKEEKEVKFEVKTHGSKRDDGPVILVVNACAS
RDLHDHVVGVCFVAQDMTVHKLVMDKFTRVEGDYKAIIHNPSPLIPPIFGADEFGWCSEW
NAAMTKLTGWHRDEVINKMLLGEVFDSTNASCLVKNKDAFVSLCILINSALAGDETEKAP
FSFFDRNGKYIECLLSVNRKVNADGVITGVFCFIQVPSHELQHALHVQQASQQNALTKLK
AYSYMRHAINNPLSGMLYSRKALKNTGLNEEQMKEVNVADSCHRQLNKILSDLDQDSVMN
KSSCLDLEMVEFVLQDVFVAAVSQVLITCQGKGIRVSCNLPERYMKQTVYGDGVRLQQIL
SDFLFVSVKFSPVGGSVEISCSLTKNSIGENLHLIDLELRIKHQGKGVPADLLSQMYEDD
NKEQSDEGMSLAVSRNLLRLMNGDVRHMREAGMSTFILSVELASAPAK
NT seq 3387 nt   +upstreamnt  +downstreamnt
atgtcttcttcaagacctactcaatgttccagttcatccagcaggacccgccaaagctcc
cgggcaaggatattagcacaaacaactcttgatgctgaactcaatgctgaatatgaagaa
tatggcgactcctttgattactccaaattggttgaagcacagagaactactggacctgag
cagcaagctcgttctgagaaggtcatagcttacttgcatcacattcagagagcaaagcta
atccaaccatttggttgcttgttggcccttgatgagaagaccttcaatgttatagcgctc
agcgagaatgcaccagagatgcttacaactgtcagccatgcagtgccaagtgttgatgat
cccccaaagctacgcattggcaccaatgtatggtctcttttcactgacccaggtgccaca
gcactgcagaaggcactgggatttgctgatgtttccttgctgaaccctatcctagttcaa
tgcaagacctcaggcaagcctttctatgccattgttcatcgggcaactggttgtttggtg
gtagactttgagcctgtgaaacctacagaatttccagcaactgccgctggggctttgcaa
tcttacaaacttgctgccaaggcaatctctaagatccagtcactgccaggtggaagcatg
gaggtgctatgcaatacggtggtcaaggaactctttgacctcacaggatatgatagagtt
atggcttataagttccatgaagatgaccatggtgaagtctttgctgagatcacaaagcct
ggtcttgaaccttatcttggcctgcattatccagctactgatatccctcaggcagccagg
tttcttttcatgaagaacaaagtccggatgatttgtgattgccgtgcaagatctatcaag
attatcgaagatgagtcgctccacttggatattagcttatgtggttcaacactgagggca
ccacacagttgtcatcttcagtatatggagaacatgaactcgattgcatcccttgtcatg
gctgttgtggttaatgagaatgaggatgatgatgaagttggggctgatcaacctgcacaa
cagcagaagaggaagaaactatggggactccttgtttgccaccatgagagccccagatat
gttcctttcccattgcggtatgcctgtgagttcttagcacaagtgtttgctgtccatgtt
aacaaggagtttgaattagagaggcaagtacgcgagaaaagcatattgaggatgcaaaca
atgctctctgacatgcttctcagggaatcctctcctctgagtatagtatcagggactccc
aacatcatggaccttgtgaaatgtgatggtgctgctcttttgtatgggggaaaagtgtgg
cggctacagaatgctccaactgagtctcagatacgtgatattgccttctggctgtcagat
gtccacagggattccactggcctgagtactgatagcctacatgatgctggatatccagga
gctgctgctcttggtgatatgatttgtggaatggcagtagctaaaataaattccaaggat
atcctgttctggttcaggtcacatacagctgctgaaatcagatggggaggtgcaaaacat
gatccatcagacaaggatgacagcagaagaatgcaccctaggctgtccttcaaggcattc
cttgaggttgtcaagatgaagagcttgccttggaatgactatgagatggatgctattcac
tcattacaacttatacttagagggacactgaatgatgacatcaagccaacaagggccgct
agtttagataatcaggttggtgatctcaagcttgatgggcttgctgaattgcaggcagtt
acaagtgaaatggttcgtctcatggaaacagcaactgtcccaatcttggctgtagatagc
aatggattggtcaatggatggaatcagaaggttgctgagttgacagggttgagagtagat
gaggctattggaagacacatacttaccgttgtagaggaatcttctgtaccagttgtccag
aggatgctgtatttagctttgcaaggcaaagaagagaaggaagtgaaatttgaggtgaaa
actcatggctccaagagagatgatggccctgttatcttggttgtgaatgcctgtgccagc
cgggaccttcacgaccatgttgttggtgtgtgctttgttgcacaagatatgactgttcat
aagttggtcatggacaaatttactcgggttgagggagactacaaagcaattattcacaat
ccaagcccgcttattcctcccatatttggtgctgacgaatttggatggtgctctgagtgg
aatgctgccatgacgaaattgaccgggtggcatagagatgaggtgatcaataagatgctt
cttggtgaggtgtttgatagcaccaacgcctcctgtcttgtgaagaataaagatgcattt
gtaagtctctgcattcttatcaacagtgcattagctggtgatgaaacagaaaaggctcca
ttcagcttcttcgaccggaacgggaagtatatcgagtgccttctttctgttaacagaaaa
gtaaatgcagatggtgtcatcactggagtattttgtttcattcaagttcctagtcatgag
ctgcaacatgcactacatgtgcagcaagcctcacagcagaatgcactaacaaagttgaaa
gcttactcctacatgagacatgcaatcaacaaccctctctcaggtatgctttactctagg
aaagcactgaagaacacaggtctgaatgaagagcagatgaaggaggtcaatgttgcagat
agttgtcaccgccagctgaataaaatactttctgacttggatcaagatagcgtcatgaac
aagtctagttgcttggatttggagatggttgagtttgtattgcaagatgtgtttgtggct
gctgtaagtcaagtactcataacttgccagggaaaagggattagagtctcttgcaaccta
ccggagagatatatgaagcaaacagtctacggggatggtgttcgactacagcagattctc
tctgacttcctattcgtctcagtgaagttctctcctgttgggggttctgttgagatctct
tgtagcctgaccaagaacagcattggggaaaaccttcatctcatagacctagaacttagg
atcaagcaccagggcaaaggagtcccagcagatctgctgtcacaaatgtacgaggatgac
aataaggagcagtcggatgaaggcatgagtcttgcggtttctagaaacctgctgaggctc
atgaatggcgatgtccgacatatgagggaagctggcatgtcaaccttcatcctcagcgtc
gaacttgcttctgctccagcaaaataa

DBGET integrated database retrieval system