KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334058
Entry
4334058           CDS       T01015                                 
Name
(RefSeq) DNA repair protein XRCC4
  KO
K10886  DNA-repair protein XRCC4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    4334058
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4334058
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     4334058
SSDB
Motif
Pfam: XRCC4 XLF V_ATPase_I DUF3810
Other DBs
NCBI-GeneID: 4334058
NCBI-ProteinID: XP_015631232
UniProt: Q7Y1H0 Q75KV7
LinkDB
Position
3:30395644..30398507
AA seq 274 aa
MATSTAAPRHSCAKLSVAVEDPKAGGGGAVFVKATWHPTRFSLAVTDGGAAWVAQASDAE
VRLRAEQWDQPVADYLALAERYLAFQQPSSTYSFHDAANGNRRLSWTFEKQGTKLEWRWK
LQPAPNTQQTIAEILDFLMDANIRLSEEVVRKTQSFDKLKQESEKCLQQSERFNIEKAEF
EQSTFSKFVAVLNSKKAKLRQLKDKLTEFESADKAPKEEDENSTDKTELFEEASDKDASV
NDEPSETGGGDLHSSPEKTAATSRGGRGRKRTRK
NT seq 825 nt   +upstreamnt  +downstreamnt
atggcgacctcgacggcggcgcccaggcacagctgcgcgaagctctcggtggcggtggag
gaccccaaggcgggcggcggcggagccgtcttcgtgaaggccacgtggcaccccacgcgc
ttctccctcgccgtcaccgacggcggcgccgcgtgggtcgcccaggcctccgacgccgag
gtgcgcctccgcgccgagcagtgggaccagcccgtcgccgactacctcgccctcgccgag
cgctacctcgccttccagcagccctcctccacctactccttccacgacgccgccaacggc
aatcgaaggctgtcatggacatttgagaaacaaggcaccaagttagaatggcgatggaaa
ctgcagcctgcacctaacactcagcagactatagctgagatcttggattttcttatggat
gcaaatatacgcttgagcgaagaggttgttaggaaaacacaatcctttgacaagttgaaa
caagaatctgagaagtgcttgcaacaaagtgaaagatttaacattgagaaagctgagttc
gaacaatccacattttcaaagtttgtggctgtcttaaattcgaagaaagccaagctcaga
caactcaaggacaaactcacagaatttgaatctgctgacaaggctccaaaggaggaggat
gagaactccactgataagacagagctttttgaggaagcaagtgacaaagatgcaagcgtt
aatgatgaaccctctgagactggtggcggcgatcttcatagctctcctgagaaaactgca
gccacctccagaggggggaggggtcgcaagaggactagaaaatag

DBGET integrated database retrieval system