KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334073
Entry
4334073           CDS       T01015                                 
Name
(RefSeq) ATP-sulfurylase 3, chloroplastic
  KO
K13811  3'-phosphoadenosine 5'-phosphosulfate synthase [EC:2.7.7.4 2.7.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00261  Monobactam biosynthesis
osa00450  Selenocompound metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4334073
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4334073
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4334073
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    4334073
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     4334073
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     4334073
SSDB
Motif
Pfam: ATP-sulfurylase PUA_2
Other DBs
NCBI-GeneID: 4334073
NCBI-ProteinID: XP_015631546
UniProt: Q84MN8 A0A0N7KI12
LinkDB
Position
3:complement(30532235..30535419)
AA seq 477 aa
MAMQAAFAASMFPQLAQRRGSDRAVVVAPPAPAPVRVAMRSGGAAAAAARGVRCRASLIE
PDGGRLVELVVPEEGGRREAARREAAALAHRVRLGRVETEWLHVLSEGWASPLRGFMREA
EFLQALHFNAIRGGDGAMVNMSVPIVLPLGDAQRRAIEASGARRVALVDAADRPLAVLSD
IEIYKHNKEERIARTWGTTAPGLPYVDEAITNAGDWLIGGDLEVIEPIKYNDGLDQYRLS
PAQLREEFARRNADAVFAFQLRNPVHNGHALLMTDTRKRLLEMGYKNPVLLLHPLGGFTK
ADDVPLSWRMKQHEKVLEEGVLNPESTVVAIFPSPMHYAGPTEVQWHAKARINAGANFYI
VGRDPAGMGHPTEKRDLYDADHGKKVLSMAPGLEKLNILPFKVAAYDTKQKKMDFFDPSR
KDDFLFISGTKMRTLAKNCQSPPDGFMCPGGWKVLVEYYDSLTPSADSSKLREAVAA
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggcgatgcaggccgccttcgccgcctcgatgttcccgcagctggcgcagcggagggga
agcgatcgcgcggtggtggtggcgccgccggcgccggcgccggtgagggtggcgatgagg
agcggtggggcggcggcggcggcggcgagaggggtgaggtgcagggcgagcctgatcgag
cccgacggggggaggctggtggagctggtggtgccggaggagggagggcggcgggaggcg
gcgcggcgggaggcggcggcgctggcgcaccgggtgaggctggggcgggtggagacggag
tggctgcacgtgctgagcgaagggtgggcgagcccgctgcgagggttcatgcgcgaggcc
gagttcctccaagcacttcatttcaacgccatccgcggcggagacggggccatggtcaac
atgtccgtgcccatcgtcctccccctcggtgacgcccagcgccgcgccatcgaggcgtcc
ggcgcccgccgcgtcgcgctcgtcgacgccgccgaccgccccctcgccgtcctcagcgac
attgagatctacaagcataacaaagaagaaaggattgcacggacatggggaacaactgca
cctgggctgccttatgttgatgaggcgattacaaatgctggtgattggttaattggtggt
gacttggaggttatagaaccaatcaagtacaatgatggtcttgatcagtatcgcttgtct
ccagcccagctgcgtgaagagtttgccagacgcaatgctgatgcggtattcgcgtttcag
cttcgcaatcctgtacacaatggacatgctttgctcatgactgatacacgcaaacgcctt
cttgagatgggttacaaaaatcctgttcttctgcttcatccattgggaggattcacaaaa
gcagatgatgtgcctcttagttggagaatgaagcagcatgaaaaggttcttgaggaaggt
gtcctcaacccagaatcaactgtcgttgcaatcttcccctctccaatgcattatgcaggg
ccaactgaagtgcaatggcatgctaaggctcgtataaatgctggtgcaaacttctacata
gttggaagagatcctgctggtatgggccacccaactgaaaagagggacctgtatgatgct
gatcatgggaaaaaggtgttgagcatggctcctgggcttgagaagctcaatatccttcct
ttcaaggtggctgcatatgacacaaagcaaaagaaaatggactttttcgatccatcaagg
aaagatgatttcctgttcatctctggcacaaagatgcgtactcttgccaagaactgccag
agcccccctgacggattcatgtgcccgggtggctggaaggtccttgttgaatactacgac
agcttgacgccatcagcggacagcagcaaactgcgcgaggcggttgcggcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334932
Entry
4334932           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: ATP sulfurylase 2
  KO
K13811  3'-phosphoadenosine 5'-phosphosulfate synthase [EC:2.7.7.4 2.7.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00261  Monobactam biosynthesis
osa00450  Selenocompound metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4334932
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4334932
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4334932
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    4334932
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     4334932
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     4334932
SSDB
Motif
Pfam: ATP-sulfurylase PUA_2
Other DBs
NCBI-GeneID: 4334932
NCBI-ProteinID: XP_015635458
LinkDB
Position
4:complement(646157..650052)
AA seq 474 aa
MATTTHLHLPNPIPPRLHASPPARLRASASLAHPRLLSGLRLSAPRPRPRHGRRAMSVTV
RSSLIDPDGGALVDLVAAPGRRXALRGEAEALPRVRLAPVDVEWAHVLAEGWASPLRGFM
REHEYLQSLHFNCIRLPDGAGVVNMSLPIVLAIGDREKEEIGSSPDVALHGPDGAVLAIL
RRVEIYPHNKEERIARTWGTTAPGLPYVDEAIAQAGNWLIGGDLEVIEPIKYNDGLDHYR
LSPQQLRNEFDKRGADAVFAFQLRNPVHNGHALLMNDTRRRLLEMGFKNPILLLHPLGGF
TKADDVPLPVRMEQHSKVLEDGVLDPETTIVSIFPSPMHYAGPTEVQWHAKARINAGANF
YIVGRDPAGMGHPTEKRDLYNPDHGKKVLSMAPGLEKLNILPFKVAAYDTVAKKMAFFDP
SRSKDFLFISGTKMRAFAKSGENPPDGFMCPGGWKVLVDYYNSLQTEEAAVATV
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggccaccaccacccacctccaccttcccaaccccatccctccccgcctccacgcctcc
ccgcccgcgcgcctccgcgcctccgcctcgctcgcccacccgcgcctcctctccggcctc
cgcctctccgcgccgcgcccgcgcccgcgccacggccgccgcgccatgtccgtcaccgtc
cggagctccctcatcgacccggacgggggcgcgctcgtcgacctcgtggcggcgccgggg
cgccgcnnggcgctgcgcggcgaggcggaggcgctcccgcgcgtccgcctcgcccccgtc
gacgtggagtgggcgcacgtgctcgccgaggggtgggcgagcccgctgcgggggttcatg
cgggagcacgagtacctccagtcgctgcacttcaactgcatccgcctccccgacggcgcg
ggcgtcgtcaacatgtcgctccccatcgtcctcgccatcggcgaccgggagaaggaggag
atcgggtccagcccggacgtcgcgctccatggccccgacggcgccgtcctcgccatccta
cgcagggtggaaatataccctcacaacaaagaagaaagaatagcaagaacatgggggaca
accgcacctggtttaccttatgtagatgaggcaatagcccaagctgggaactggctaatt
ggtggtgatctggaagtgattgaacccatcaaatataacgatggtcttgatcactatagg
ctctcaccccagcaacttaggaatgaattcgataagcgaggggctgatgctgtgtttgcc
ttccaattgagaaatccagtacataatgggcatgccctgttgatgaatgatactagaagg
cgcctcttggaaatgggcttcaagaatcccattctactgctgcaccctttaggtggcttc
acgaaagctgatgatgtcccgttgcctgtgagaatggaacaacacagcaaggttttagaa
gatggtgtccttgatcctgagactactatagtgtctattttcccctccccgatgcattat
gctggtccaacagaagtgcaatggcatgcaaaggcacggattaacgctggtgccaatttc
tacattgtgggtcgtgatccagctggaatgggccatccaacagaaaagagggatctgtac
aacccagatcatggaaagaaggtccttagcatggccccaggtttagagaaactcaacata
ttgcccttcaaggtagcagcatatgatacagtggcgaagaagatggcgttctttgatcct
tcacggagtaaagattttctgttcatctcaggaaccaagatgcgggcttttgcgaaaagt
ggagagaaccctcctgacggtttcatgtgccctggtgggtggaaagttcttgtggactac
tacaatagtttgcaaaccgaagaagcggctgtggcaactgtatga

DBGET integrated database retrieval system