KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334308
Entry
4334308           CDS       T01015                                 
Name
(RefSeq) inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Module
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4334308
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334308
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     4334308
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4334308
  Exosomal proteins of breast cancer cells
   4334308
SSDB
Motif
Pfam: IMPDH NMO FMN_dh ThiG His_biosynth CBS BATS NanE Glu_synthase DUF561 DUF4350
Other DBs
NCBI-GeneID: 4334308
NCBI-ProteinID: XP_015630946
UniProt: Q9AY75 Q10CU8
LinkDB
Position
3:32365743..32371201
AA seq 501 aa
MAASSADLADDGFPAPRLFSQGVSYTYDDVIFLPGYIGFPADAVDLSTRLSRRIPLSIPC
VASPMDTVSEAAMAAAMASLGAAAVVHCNTEPHLQASIVRAAKSRRLPFVSSVPLFSPAS
TPSLSDFAGHDYGLVTERGDSLSKLVGVAVAAETSSRQAPLPVSEYMRPAPRSVSASFDF
EQAAAFLADEGLDYAPLVSDDSEVIDLITVNDVERIRSYPKLGKPSLGADGKFVVAASIG
TREDDKRRLEQLVKAGANAIVVDSSQGNSIYQIDMIKYAKKMYPEVDLIGGNVVTIAQAQ
NLVASGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVASYAKDHNVPVIADGGISNSG
HIVKALSLGASTVMMGSFLAGSHEAPGTYEYKDGHRVKKYRGMGSLEAMTKGSDARYLGD
TLKLKVAQGVVGAVADKGSVLRFIPYTMQAVKQGFQDLGASSLQSAHELLRSETIKLEVR
TGAAQVEGGIHGLVSYEKKAF
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcggcgagcagcgccgatctcgccgacgacggcttcccggcgccgcgcctcttctcg
cagggcgtctcctacacctacgacgacgtcatcttcctcccgggctacatcgggttcccg
gccgacgccgtggacctctccacccgcctctcccgccgcatccccctctccatcccctgc
gtggcctcccccatggacaccgtctccgaggccgccatggccgccgccatggcatccctc
ggcgccgccgccgtcgtccactgcaacaccgagccccacctccaggcctccatcgtccgc
gccgccaagtcccgccgcctcccgttcgtctcctccgtccccttattctcccccgcctcc
accccatccctctccgacttcgctggccacgactacggcctggtcacggagcgcggcgat
tcgctctccaagctcgtcggcgtcgctgttgcagccgagacctcctctcgtcaggctccc
ctccctgtctccgagtacatgcgccccgccccgcgctcggtgtccgcctcttttgatttc
gagcaggcggccgcctttctagcggacgagggtttggattatgcccctcttgtatccgat
gatagcgaggtaatcgacctcatcactgtcaatgatgtggagcgcatccggagctatccg
aagctaggcaagccgtctcttggagcggacgggaagtttgttgttgcggcttccattggg
acccgtgaggatgacaagcgaaggctggagcagctagttaaggcaggggcaaatgcgatt
gttgtagatagctcgcaggggaactctatctaccagattgatatgatcaagtatgcaaag
aagatgtacccggaagtggacttgattggaggtaatgtggtgacgattgcgcaggcacag
aatttagttgcttctggggtggatggattgcgtgttgggatgggctctggctcaatttgc
actacccaggaggtttgtgccgtgggccgaggacaggctacagcagtgtataaggttgca
tcttatgccaaagatcacaatgtgccagtcattgcggatggtggaatttcaaactctgga
catattgtgaaggctttgtctctgggggcatccactgttatgatgggtagcttcttggct
ggcagccatgaagctcctggtacttacgagtacaaggatggccaccgtgttaaaaaatac
cgaggcatgggctctctcgaagcaatgacaaaggggagtgacgccaggtacctaggcgat
accctcaagcttaaagtcgcccagggagttgttggagcagttgctgataaaggttctgtg
ctgaggttcattccttatacaatgcaagctgttaagcaagggttccaagatcttggtgcg
tcatctttgcagtcagctcatgagctgctgcgatcggagactatcaaattagaggtgagg
actggcgccgcgcaagttgaaggggggatacatgggctagtgtcgtacgagaagaaggca
ttctag

DBGET integrated database retrieval system