KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334349
Entry
4334349           CDS       T01015                                 
Name
(RefSeq) peroxisomal (S)-2-hydroxy-acid oxidase GLO1
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa04146  Peroxisome
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4334349
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4334349
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     4334349
SSDB
Motif
Pfam: FMN_dh IMPDH NMO Glu_synthase ThiG His_biosynth TMP-TENI DHO_dh
Other DBs
NCBI-GeneID: 4334349
NCBI-ProteinID: XP_015629653
LinkDB
Position
3:32624619..32632434
AA seq 706 aa
MAGSNPPPKPWERAGTSSGPAPFKPPSGGSTSDIVEASGTAKPGEVVSAAESNVASNVNS
TISRPVPPRPWQQQGYGNSYGGYGSSMYSSLGGFGGPYSSGGLYGNNMYSSYGGGYGGMY
GSSGMYGGSMYNSGMGGPYGGYGMGMGAYNQGPNSFGPPAPPPGFWMSFLRVMHGVVNFC
GRVAFLFSQNTQAFHMFISALLQLCDRTGMLYGELARFVLRLLGIKTKAKKGGVQGAETS
SFEGPGHHFAEAPKANNSWDSVWTDDGSGKPFPFSRFSPNKSPRLPPYLCLHVQKLKDLS
PSPILPAPTPLTTPSSCSCSFLPVSLKSGAGFTRQEKMGEITNVMEYQAIAKQKLPKMIY
DYYASGAEDEWTLKENREAFSRILFRPRILIDVSKIDMSATVLGFKISMPIMIAPSAMQK
MAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVEQLVR
RAERAGFKAIALTVDTPRLGRREADIKNRFVLPPYLTLKNFEGLDLAEMDKSNDSGLASY
VAGQIDRTLSWKDVKWLQSITSLPILVKGVITAEDARLAVHSGAAGIIVSNHGARQLDYV
PATISALEEVVTAAAGRIPVYLDGGVRRGTDVFKALALGAAGVFIGRPVVFALAAEGEAG
VRNVLRMMREEFELTMALSGCTSLADITRAHIYTDADRLARPFPRL
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggcaggaagtaatccaccacccaaaccatgggaacgtgctggaacttcatctggtcca
gcgcctttcaagcccccatccgggggtagcactagtgatatcgtcgaagcttctggcaca
gcaaaacctggggaagttgtttctgccgcagagagcaatgttgcttccaatgtgaacagc
accatctctaggcctgtgcccccacggccttggcagcagcaaggatacggaaattcttat
ggaggttatggctccagtatgtatagttcgcttggtgggtttggtggaccttatagtagc
ggcggactttacggaaataacatgtattcaagttatggaggaggttatgggggtatgtat
ggaagttctggaatgtacggtgggtccatgtataatagcgggatgggaggtccctatggt
ggctatggtatgggcatgggtgcttacaaccaaggtccaaattcatttgggccaccagca
ccaccccctggtttttggatgtccttcctgcgagtgatgcatggtgttgtgaatttttgt
gggcgagttgctttcctttttagccagaacacacaggcattccacatgtttatctcagct
cttttgcagctatgtgatcggactggaatgctttatggtgaacttgcgaggttcgttcta
cgcttgcttgggatcaaaacaaaagcaaagaagggtggggttcagggcgcagaaacttct
tcgtttgaaggtccagggcatcattttgctgaggcaccaaaagctaacaactcctgggac
agtgtctggactgatgatggtagtgggaagcccttccctttctctcgcttctcccctaac
aaatctccacgtctccccccctatctttgtcttcatgtgcagaaactcaaagatctctct
ccctcacctatattacctgcaccaacaccactgaccactccctcctcctgttcttgctcc
ttcctcccagtgtctctcaagagcggtgcagggttcacaaggcaggagaaaatgggggag
atcaccaatgtcatggagtaccaggccatcgcgaagcagaagcttccgaagatgatctac
gactactacgcctctggagctgaggatgagtggactctcaaggagaacagggaggcattc
tccaggatcttgtttcgtccccgcatcctgatcgatgtctcaaagatcgacatgtccgca
actgttcttgggttcaagatatcaatgcccataatgattgctcccagtgccatgcagaag
atggctcaccctgacggagagtatgcaacagccagggcagcttcagcagcaggaactata
atgacactgtcatcttgggctacttcaagtgttgaggaggtcgcctcaactggaccagga
atccgtttcttccagctatacgtgtacaaggacaggaatgtggttgagcagcttgtcaga
agagccgagagagctgggttcaaggcgatcgcactgaccgtggacactccgcgactggga
cgcagggaagctgacatcaagaacaggttcgttctgccaccatacttgacactgaagaat
ttcgaaggcctggacctcgcagagatggacaagagcaacgattccgggctggcctcctac
gtcgccgggcagatcgatcgcacgctcagctggaaggatgtgaagtggctgcagagcatc
acgtcgctgccgatcctcgtcaagggcgtcatcaccgcggaggatgcgaggctggccgtg
cactccggcgcggcggggatcatcgtgtcgaaccacggcgcgcggcagctggactacgtc
ccggcgaccatcagcgccctggaggaggtggtcacggcggcggcggggcgcatcccggtg
tacctcgacggcggcgtccgccgcggcaccgacgtcttcaaggcgctcgccctcggcgcc
gccggcgtcttcatcgggaggccggtggtgttcgcgctggcggcggagggggaggccggg
gtgaggaacgtgctgcggatgatgcgggaggagttcgagctcaccatggcgctcagcgga
tgcacctcgctcgccgacatcacccgcgcccacatctacaccgacgccgaccgcctcgcc
cgccccttccccaggttgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337048
Entry
4337048           CDS       T01015                                 
Name
(RefSeq) peroxisomal (S)-2-hydroxy-acid oxidase GLO3 isoform X1
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa04146  Peroxisome
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4337048
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4337048
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     4337048
SSDB
Motif
Pfam: FMN_dh IMPDH NMO Glu_synthase ThiG His_biosynth DHO_dh TMP-TENI
Other DBs
NCBI-GeneID: 4337048
NCBI-ProteinID: XP_015635502
UniProt: Q7FAS1
LinkDB
Position
4:31688638..31692592
AA seq 367 aa
MELITNVSEYEQLAKQKLPKMIYDYYASGAEDQWTLKENREAFSRILFRPRILIDVSRIN
MATNVLGFNISMPIMIAPSAMQKMAHPEGELATARAASAAGTIMTLSSWSTSSVEEVNSA
APGIRFFQLYVYKDRNIVRQLVRRAELAGFKAIALTVDTPRLGRREADIKNRFNLPPHLV
LKNFEALDLGKMDKTNDSGLASYVASQVDRSLSWTDVKWLQTITSLPILVKGVMTAEDTR
LAVESGAAGIIVSNHGARQLDYVPATISCLEEVVREAKGRLPVFLDGGVRRGTDVFKALA
LGASGVFIGRPVLFSLAVDGEAGVRKVLQMLRDELELTMALSGCTSLAEITRNHVITDSD
RIRRSRL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggagctaatcacaaacgtctccgagtatgagcagcttgcaaagcagaagctgccgaag
atgatctacgactactacgcctctggtgcagaagatcaatggactctcaaggagaacagg
gaggccttctcaagaattctgtttcgaccgcgaatactgattgatgtatcccgtatcaac
atggctacaaatgtcttgggcttcaacatttccatgcccataatgattgctccctcagcc
atgcagaaaatggcccaccccgaaggagagcttgctactgcaagagcagcttctgctgca
ggaacaataatgacattgtcttcatggtccacttctagtgttgaagaggttaattcagca
gcgccggggatacgtttcttccaactctatgtttacaaggataggaatatagtacggcaa
cttgtcagaagggctgaattggctggttttaaggcgattgcactcactgtcgacactcca
aggcttggtcgcagggaagctgacatcaagaacagattcaacttacctccacatctggta
ttgaagaattttgaagcgctggatctcggcaagatggacaagacaaatgattctggcctt
gcttcctatgttgctagccaagttgaccgctctctgtcttggacggacgtgaagtggcta
cagacaatcacctcgttgccgatcttagtgaaaggagtcatgactgcagaagatactagg
cttgctgtcgaaagtggcgcggccggtatcatcgtgtccaaccatggagctcgccagcta
gattatgttcctgcaactatcagctgcctggaagaggtcgtcagggaggcaaaggggcgg
ctgccggtgttcctcgacggcggcgtccgccgtggcacggacgtgttcaaggccctggcg
ctgggagcttcaggagtatttattggcaggccggtgctgttctcgctggccgtggacggc
gaggccggcgtgaggaaggtgctgcagatgctccgcgacgagctggagctcaccatggcg
ctcagcggatgcacgtcgctggccgagatcacccgcaaccacgtcatcaccgacagcgac
aggatccgccgctccaggctgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342420
Entry
4342420           CDS       T01015                                 
Name
(RefSeq) peroxisomal (S)-2-hydroxy-acid oxidase GLO5 isoform X1
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa04146  Peroxisome
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4342420
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4342420
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     4342420
SSDB
Motif
Pfam: FMN_dh IMPDH NMO Glu_synthase ThiG DUF561 His_biosynth TMP-TENI DHO_dh
Other DBs
NCBI-GeneID: 4342420
NCBI-ProteinID: XP_015646859
UniProt: Q6YT73
LinkDB
Position
7:2797691..2801348
AA seq 369 aa
MGEITNVTEYQAIAKQKLPKMIYDYYASGAEDEWTLQENREAFARILFRPRILIDVSKID
MATTVLGFKISMPIMIAPSAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVAST
GPGIRFFQLYVYKDRRVVEQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLT
LKNFEGLELGKMDQASDSGLASYVAGQIDRTLSWKDVKWLQTITTLPILVKGVITAEDTR
LAVENGAAGIIVSNHGARQLDYVPATISALEEVVKAARGQLPVFLDGGVRRGTDVFKALA
LGAAGVFIGRPVVFSLAAAGEAGVRNVLQMLRDEFELTMALSGCTSLADITRNHVITEAD
KLGVMPSRL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgggggagatcaccaatgtcacggagtaccaggccatcgcgaagcagaagcttccgaag
atgatctacgactactatgcatctggggccgaggacgagtggactctccaggagaacagg
gaggccttcgccaggatcctgtttcgcccacgcatactgatcgacgtatccaagattgac
atggccacaacagtcctggggttcaagatttcaatgcccattatgattgctccctctgcc
atgcagaagatggctcacccagatggagagtatgcaactgcgcgtgctgcatcagcagcg
ggcactataatgacattgtcatcatgggctacttcaagcgttgaggaggttgcctcaact
ggaccagggattcgtttcttccagctttatgtttacaaagacaggagggtggtggagcag
cttgttaggagagctgaaagggctggattcaaggcgattgcgcttacggtggatactccg
cgacttggccgtagggaggctgacatcaagaacaggtttgttctgccaccatttttgaca
ctgaagaactttgaaggcctggagctggggaaaatggaccaggctagcgattcaggactg
gcttcttacgtcgccgggcaaatcgatcgcaccctgagctggaaggatgtgaagtggctg
cagaccatcaccacgctgccgatcctggtgaagggagtgatcactgcagaagacacgagg
ctcgccgtggagaacggcgcggccggcatcatcgtgtccaaccacggcgcccgccagctg
gactacgtcccggccaccatcagcgccctcgaggaggttgtgaaggcggctcgcgggcag
ctccccgtcttcctcgacggcggcgtccgccgcggcaccgacgtcttcaaggcgctcgcc
ctcggcgccgccggcgtcttcatcgggaggccggtggtgttctcgctggcggcggcgggg
gaggccggagtccggaacgtgctgcagatgctccgcgacgagttcgagctcaccatggcg
ctcagcggctgcacctccctcgccgacatcacccgcaaccacgtcatcaccgaggccgac
aagctcggcgtcatgccgtctcgcttgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343908
Entry
4343908           CDS       T01015                                 
Name
(RefSeq) peroxisomal (S)-2-hydroxy-acid oxidase GLO4 isoform X1
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa04146  Peroxisome
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4343908
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4343908
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     4343908
SSDB
Motif
Pfam: FMN_dh IMPDH ThiG His_biosynth NMO Dus Glu_synthase TMP-TENI DHO_dh PA
Other DBs
NCBI-GeneID: 4343908
NCBI-ProteinID: XP_015647067
UniProt: Q8H3I4
LinkDB
Position
7:25408312..25413158
AA seq 366 aa
MEDNLPVNVREYQELAKKALPKMAYDYINGGAEDEHTLRENIAAYTRIILRPRVLVDVSK
IDMSTTLLGYTMRSPIIVAPTGGHKLAHPEGEKATARAAASCNAIMVLSFSSSCKIEDVA
SSCNAIRFYQLYVYKNRNVSATLVRRAESCGFKALLLTVDTPMLGRREADIRNKMVFPRS
GNLEGLMTTDDHDTTNGSQLERFARATLDPSLSWKDIEWLKSITSMPIFLKGIVTAEDAR
RAVEAGVAGVIVSNHGARQLDYAPATIAALEEVVRAVAGAVPVLVDGGIRRGTDVFKALA
LGARAVMVGRPVFFGLAARGEAGARHVIEMLNGELEVAMALCGCRSVGEITRSHVMTEGD
RIRSLL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggaggacaatctaccagtcaatgtccgggagtatcaagaactcgccaaaaaagcgttg
ccaaagatggcttatgattacatcaatgggggagcagaggatgagcacacactgagggag
aatatcgcagcatacacaagaattatattacgacctcgcgttcttgtggatgtgagcaag
atagacatgtcaacaactttattaggatacaccatgcgttcacccataattgtggctcca
actggggggcacaaattagcacatccagaaggggagaaggctacagcaagagctgcagca
tcatgtaacgccataatggttctttccttttcttccagttgcaagattgaggatgttgcc
tccagttgcaatgccattcgcttttatcagctatatgtgtataagaataggaatgtttca
gcaacattagtacggcgggccgagagttgtggattcaaggcacttcttttgacagttgac
actcctatgctcggtcggcgtgaagcagatatccgaaacaaaatggttttcccacggagt
ggtaatctcgaaggtttaatgacaacagatgaccatgataccacaaacggttctcagctc
gaacgattcgcacgagcgacgctggatccatcattatcatggaaggatatagagtggctc
aagtccataaccagcatgccgatctttctcaagggcatcgtcaccgctgaggacgcgagg
agagcagtggaggccggggtggccggcgtgatcgtctccaaccacggcgcgcggcagctg
gactacgcgccggcgaccatcgccgccctggaagaggtggtcagggcggtggccggcgcc
gtgccggtgctggtcgacggcggaatccggcgaggcactgacgtgttcaaggccctggcg
ctcggcgcacgggcggtcatggttgggaggccggtgttcttcgggctggcggcgaggggg
gaggcaggcgcgaggcacgtgatcgagatgctcaacggcgagctggaggtggccatggcg
ctctgcggctgccggagcgtcggcgagatcacccgcagccatgtcatgaccgagggtgac
aggatcaggtccctgctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266366
Entry
9266366           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: peroxisomal (S)-2-hydroxy-acid oxidase GLO2
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa04146  Peroxisome
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    9266366
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    9266366
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     9266366
SSDB
Motif
Pfam: FMN_dh
Other DBs
NCBI-GeneID: 9266366
NCBI-ProteinID: XP_015635506
LinkDB
Position
4:31692736..31700018
AA seq 420 aa
MNTKRKEHKKAPQFLLPVQEYKKDTSTDKIPEPCPPLLSKQEMALVTNVCEYEELAKHKL
PKMVYDFYAVDAEDQWTLRENSEAFSRILFQPVVLVDVSCIDMSMSVLGYNISMPIMIAP
TALHKLAHPEGELATARAAAAAETIMTLSSWSSCSIEEVNLAGPGVRFFQLSIYKDRNLV
QQLIQRAEKAGYKAIVLTVDAPWLGRREADVKNRFTLPQNVMLKIFEGLDQGKIDETNGS
GLAAYVASQIDRSFSWKDIKWLQTVTSLPVLVKGIITAQDTRIAIEYGAAGIIMSNHGGR
QLDYLPATISCLEELCLKTARISGCQGSKWACAGVHRQRFSPRHXDVFKALALGASGVFI
GRPVLFSLAIDGEAGVRNALRMLRDELEITMALSGCTSVKEITRGHVVTESDRIRRCSRL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaacacaaagaggaaagagcataaaaaagccccccaattcctccttccagttcaagag
tacaagaaagacacaagcacagacaaaattcctgagccctgccccccgttgcttagtaaa
caggagatggctctggtcacaaatgtgtgcgaatatgaagaacttgcaaagcacaaactg
ccaaagatggtttatgatttctatgctgttgacgcagaagaccaatggactctcagggag
aacagtgaggcattctccagaattttgtttcagccggttgtattggttgatgtgtcctgt
atcgacatgtctatgagtgtcttaggctacaatatttccatgcccattatgattgctcct
acggctttgcacaaattggcacatcctgaaggagagcttgctactgccagagctgcagct
gctgcagaaactataatgacattgtcttcatggtcatcttgtagtattgaagaggttaat
ttggcagggcctggagttcgtttcttccaactttcaatatacaaggacaggaacttagtg
caacagcttatccaaagggctgaaaaggctggctataaggcaattgtactgactgttgat
gctccatggcttggtcgcagggaagctgatgtcaagaacaggttcaccttgcctcaaaat
gtcatgttgaagatctttgaggggctggatcaagggaagatagatgagacgaatggttct
ggtcttgctgcctatgtcgctagccagattgaccgctctttttcttggaaggatatcaag
tggttacagacagttacatcattgccggtcttagtgaaaggaattataacagcacaagac
actagaattgctatagaatacggtgcagctggtatcatcatgtccaaccatggcggccgc
cagctagactatcttcctgcaaccatcagctgtctagaagagctatgcctgaaaacagca
cgaatctcaggttgtcagggaagcaaatgggcgtgtgccggtgttcatcgacagcggttt
tcgccgcggcacnncgacgtgttcaaggccctggcattgggagcttcaggggtatttatt
ggtaggccggtgctgttctccctcgccatcgacggcgaggccggcgtgaggaacgcgctg
cggatgctgagagacgagctggagatcaccatggcgctcagcggctgcacgtcggtgaag
gagatcacgcgcggccacgtcgtcaccgagagcgacaggatccgccgttgttctcggctg
tag

DBGET integrated database retrieval system