KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334354
Entry
4334354           CDS       T01015                                 
Name
(RefSeq) cullin-4
  KO
K10609  cullin 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4334354
  09124 Replication and repair
   03420 Nucleotide excision repair
    4334354
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4334354
   03400 DNA repair and recombination proteins [BR:osa03400]
    4334354
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334354
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     4334354
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      4334354
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      4334354
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4334354
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Pox_VLTF3 DUF808
Other DBs
NCBI-GeneID: 4334354
NCBI-ProteinID: XP_015632421
UniProt: Q10CD7
LinkDB
Position
3:32672019..32679109
AA seq 836 aa
MSHPHATAPKRPGHFSSSSAAASSPTSPAQPHMKKAKFPGSSSSSSSAAAPGVTEKNGLH
VDPTAAAARTGGRTNGEEDAEMVLADQEELAAPSASAPAGVAANLFRKKATLPQPSAARK
PLRIKIGQPKLPTNFEEDTWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLY
ERIKKECEVHISAKISALVGQSPDLVVFLSLVQRTWQDFCDQMLIIRGIALLLDVKYVKN
VANICSVWDMGLKLFRKHLSLSPEIEHKTVTGLLRLIESERLGEAIDRTLLSHLLKMFTA
LGMYSESFEKPFLECTSEFYATEGVKYLQQSDIPDYLKHVETRLQEEHERCILYLEANTR
KPLITATEKQLLQRHTSAILEKGFTMLMEANRVKDLSRMYTLFQRVDAIELLKQALSSYI
RGTGQGIIMDEEKDKELVPFLLEFKASLDRILEESFAKNEAFSNTIKESFEHLINLRQNR
PAELIAKFLDEKLRAGNKGTSEEELEGILDKVLVLFRFIQGKDVFEAFYKKDLAKRLLLG
KSASIDAEKSMITKLKTECGSQFTNKLEGMFKDIELSKEINESFKQSSQARTKLPSGIEM
SVHVLTTGYWPTYPPMDVKLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFP
KGKKELAVSLFQSVVLMLFNDAQKLSFLDIKESTGIEDKELRRTLQSLACGKVRVLQKMP
KGRDVEDKDEFVFNEEFSAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRI
MKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLIDREYLERDRSNPQIYNYLA
NT seq 2511 nt   +upstreamnt  +downstreamnt
atgtctcacccccacgccaccgcccccaagcgccccggccacttctcctcctcctccgcc
gccgcctcctccccgacctcccccgcgcagccgcacatgaagaaggccaagttccccggc
tcctcctcctcctcctcctccgccgccgcccccggggtcaccgagaagaacgggctccac
gtcgatcccacggccgccgccgcccggaccggtgggcgcaccaacggcgaggaggatgcg
gagatggtgctcgccgaccaggaggagctcgccgctccgagcgcatcggccccggcgggg
gtcgccgccaacctcttccggaagaaggccacactcccccagccatccgccgcccgcaag
cccctccgaatcaaaataggtcagccaaaattgccaacaaactttgaggaggatacatgg
gctattttgaaagatgctattacagctatatttctaaaacagaaactttcgtgcgatgtt
gaaaaactttaccaggctgcaggtgacctttgtctacacaagctaggcgcaaatctatac
gaacgcataaagaaagaatgtgaagtacacatatcggcaaaaatatcagcattagtgggt
caaagtccagatttagtagtatttttgtctctggtgcaaagaacatggcaagatttttgc
gatcagatgttgattattcgtggtattgctttacttcttgatgtaaaatatgtcaagaat
gttgcaaacatttgttcagtgtgggacatggggttgaagctattccgcaagcatctttca
ctgtctccggagattgaacacaaaactgttactggtcttctaagattaattgagagtgag
aggcttggtgaagcaatagacaggacattacttagtcatcttctgaagatgtttactgct
cttggaatgtattctgagagttttgaaaagccctttctggagtgtacatctgaattttat
gctactgaaggtgttaaatatttgcagcagtctgatattccagactatctcaagcatgtg
gagacaaggttgcaagaagaacatgaaaggtgtattctatatttggaagctaacactagg
aagccgcttataacagctacagaaaagcaattattgcagcggcacacatctgcaattctt
gagaagggattcacaatgcttatggaagcaaatcgtgtaaaagacctctcgaggatgtac
acactcttccagagggttgatgccattgagttgctaaagcaagcacttagttcatatatt
cggggcacaggccagggcattatcatggatgaagaaaaggacaaagaactggtgcccttt
cttctggaatttaaggcatcgcttgatagaatattggaggaaagttttgccaaaaatgag
gctttctccaatacaataaaagagtcattcgaacatcttatcaatttacgccagaatcga
cctgctgaattgattgcgaagtttcttgatgagaaacttcgagctggaaataaaggtacc
tccgaagaagagctggagggaatattggataaagttttggttctgttccgatttatacaa
ggaaaagatgtatttgaggcattctacaagaaggatctggctaagaggttgctgctgggg
aagagtgcatcgatagatgctgaaaaatcaatgataacaaagctcaaaactgagtgtgga
agtcaatttaccaacaagctggagggaatgttcaaggacattgaattatccaaagaaata
aatgagtctttcaagcaatcatctcaagcaaggacaaagcttccatctggcattgaaatg
agtgttcacgtgcttacaacaggctattggccaacatatccaccaatggatgtgaaactc
ccccatgaacttaatgtctatcaggatatatttaaagaattctatttgagcaagtatagt
ggaaggcgtttgatgtggcaaaactcattgggtcactgtgtattaaaagcagagttccca
aaaggtaaaaaggaacttgcggtgtcactatttcagagtgtggttttgatgttgttcaat
gatgcacaaaaactaagcttcctcgatatcaaggaatcgactggtattgaggataaagaa
ttgcgaagaacgctgcaatcacttgcatgcggtaaagttcgggttctccaaaagatgcca
aaagggcgagacgtagaagataaggacgaatttgtatttaatgaagaatttagtgcccct
ctctatcgcataaaggtgaatgctattcagatgaaggagacggttgaagaaaacacaagc
acaactgagagagtattccaggacagacagtatcaggtggatgctgccatagttcgaata
atgaagacacgtaaaaccctcagccacacgcttctaataactgagctttttcagcagctc
aagttcccaatcaagccatcggatatcaagaaaagaatagagagcctaatcgacagggag
tacctggagagagacaggagtaacccccagatctacaattacctggcttga

DBGET integrated database retrieval system