KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334389
Entry
4334389           CDS       T01015                                 
Name
(RefSeq) replication factor C subunit 5
  KO
K10756  replication factor C subunit 3/5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4334389
   03420 Nucleotide excision repair
    4334389
   03430 Mismatch repair
    4334389
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4334389
   03036 Chromosome and associated proteins [BR:osa03036]
    4334389
   03400 DNA repair and recombination proteins [BR:osa03400]
    4334389
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    4334389
  DNA Replication Termination Factors
   ELG1-RFC complex
    4334389
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    4334389
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     4334389
  Check point factors
   HRAD17(Rad24)-RFC complex
    4334389
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA Rad17 AAA_16 Sigma54_activ_2 AAA_5 DUF5906 RuvB_N DUF815 DNA_pol3_delta RsgA_GTPase ABC_tran Mg_chelatase AAA_22 Rep_fac_C AAA_29 AAA_2 AAA_24 FtsK_SpoIIIE TsaE RNA_helicase ATPase_2 T2SSE
Other DBs
NCBI-GeneID: 4334389
NCBI-ProteinID: XP_015630600
UniProt: Q852K3
LinkDB
Position
3:complement(32964606..32967806)
AA seq 354 aa
MLWVDKYRPKTLDKVTVHDQVAQNLKKLVAEQDCPHLLFYGPSGSGKKTLVMALIKQMFG
AGADKVKMENKTWKIDTGSRNIEIELAMLSSAHHVEMNPSDAGFQDRYVVQEVIKEMAKN
RPIDAKGKRAFKVLVLNEVDKLSREAQHSLRRTMEKYSASCRLILCCNSSSKVTEAVRSR
CLNVRVNAPSEDQIVQVLEFIGKKENLQLPFGFAARIAAQSNRNLRRAILFFETCKVQQY
PFTSNQVAPPLDWEQYVSEIAADIMKEQSPKRLFAVRQKFYELLVNCIPPESILKKLLAE
LLKKLDSDLKHEICHWAAHYEHKMRLGSKAIFHLEAFVAKFMSIYKEFLVSTFG
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgctgtgggtggacaagtacaggccgaaaaccctagacaaggtcaccgtccatgaccag
gtcgcgcaaaacctcaagaagctggtggcggagcaggattgcccgcacctgctcttctat
gggccgtcggggtccgggaagaaaaccctagtcatggccctcatcaagcagatgttcggc
gcaggcgcggataaggtgaagatggagaacaagacatggaagatcgatactgggtcgagg
aatattgagatagaactggcaatgttgtcgagcgcccaccatgtggagatgaaccccagc
gatgctgggtttcaggacaggtatgttgttcaggaagtcattaaagagatggcgaagaat
aggccaattgatgccaagggcaagagagcatttaaagtccttgtccttaatgaagtcgac
aagctctcacgagaagcccagcattcccttcgtaggacaatggagaagtacagtgcatca
tgcaggctgatattgtgctgtaatagctcatcaaaggtgacagaggctgtaaggtctcgt
tgcttgaacgtgcgagtgaatgcacccagtgaagaccagatcgtccaagttctggagttc
attgggaagaaagaaaatctgcagcttccatttggatttgctgctaggatagcagcacaa
tcgaaccgtaacctgagacgagcgatactgttttttgagacctgcaaagtccagcaatac
ccatttacatcaaatcaagtagcacctcctcttgactgggagcaatatgtgtcagaaata
gcagctgatatcatgaaagaacaaagccctaaaaggctatttgctgtgcgccagaagttc
tacgaattacttgtgaattgtatcccacctgaaagcatcttaaagaagttgttggcggag
ttactgaagaaattagactctgacttgaaacatgaaatttgtcactgggctgcacactat
gaacacaagatgcgtcttgggtccaaggccatttttcacctagaagctttcgtcgccaag
ttcatgagcatctacaaggaatttcttgtctctacatttggctga

DBGET integrated database retrieval system