KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334459
Entry
4334459           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 35B
  KO
K18468  vacuolar protein sorting-associated protein 35
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4334459
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4334459
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    4334459
SSDB
Motif
Pfam: Vps35
Other DBs
NCBI-GeneID: 4334459
NCBI-ProteinID: XP_015632028
UniProt: Q84SZ6 A3ANQ3
LinkDB
Position
3:33424913..33433060
AA seq 793 aa
MLPDGGADDEERWLAEGIAGVQQNAFYMHRALDSNNLKDALKYSAQMLSELRTSRLSPHK
YYDLYMRAFDEMRKLEMFFREETRRGSCSVVDLYELVQHAGNVLPRLYLLCTVGSVYIKS
KEAPAKDVLKDLVEMCRGIQHPLRGLFLRSYLSQISRDKLPDIGSEYEGDADSINVAVEF
VLQNFIEMNKLWVRMQHQGPVREKEKRGKERNELRDLVGKNLHVLSQIEGVDLDMYKETV
LPRILEQVVNCKDELAQFYLMDCIIQVFPDEYHLQTLETLLSAFPQLQPNVDIKTVLSQL
MDRLSSYAAASPEVLPEFLQVEAFAKFSNAIGKVIEAQVDMPVVGAVTLYVSLLTFTLRV
HPDRLDYVDQVLGACVKKLSGNAKLEDSRATKQIVALLSAPLEKYSNIVTALELSNYPRV
MDYLDNSTTKVMALVIIQSIMKNTTCISTSDKIEALFDLIKGLIKDMDGAQNDELDDEDF
KEEQNSVARLIHMLHNDDHEEMLKILCTVQKHILQGGPKRLPFTVPSLVFSALKLVRRLQ
GQDGDVIGEEVPATPKKIFQILHQTIEALSCVPSPELALRLYLQCAEAANDCDLEPVAYE
FFTQAFILYEEEIADSKAQITAIHLIIGTLQRMNIFGVENRDTLTHKTTGYSAKLLKKPD
QCRAVYACSHLFWTDDQDGIMDGERVLLCLKRALRIANAAQQMANVTRGSSGSVALFIEI
LNKYLYFFEKGIPEITNTVIQDLIELIRTEKQSENTVADPSTEAFFASTLRYIEFQKQKG
GSIGEKYEQIKTT
NT seq 2382 nt   +upstreamnt  +downstreamnt
atgctgccggatggcggcgccgacgacgaggagcggtggctcgccgagggcatcgccggc
gtccagcagaacgccttctacatgcaccgcgccctcgattcgaacaacctcaaggatgcg
ctcaagtactcggcgcagatgctctccgagctgcggacctcgcggctctcgccgcacaag
tattatgatctatatatgagggcgtttgatgagatgcggaagctggagatgttcttcagg
gaggagacccgtcgtggcagctgctccgttgttgatttgtatgagcttgtgcagcatgct
ggcaacgtactgcccagactctatctcctctgcacagtaggatctgtgtacattaaatca
aaagaggctcctgcgaaagacgttcttaaagaccttgttgaaatgtgtcgaggcatccaa
catcctcttcgtgggcttttcctaagaagctacctatctcagataagccgagacaaactg
ccagatattggttccgagtatgaaggggatgctgacagcattaacgtcgcagttgagttt
gttcttcagaatttcatagaaatgaacaaactctgggtccgaatgcaacatcagggccct
gttcgagagaaggagaagcggggaaaagaaagaaatgaactgcgtgatttggtaggcaaa
aaccttcacgttctaagccagattgagggtgttgaccttgacatgtacaaagaaactgtc
cttccaaggatattagaacaggtggttaattgtaaggatgaacttgcacaattctacctg
atggactgcataatacaagtctttccagacgaataccatttacagacattggaaacattg
ttgagcgcatttccgcaactacagccaaatgttgatatcaaaaccgtgctgtctcaactc
atggacaggttatcaagctatgctgccgcaagtcctgaagtattgccagaattcttgcaa
gttgaagcttttgcaaagttcagcaatgctattggaaaggtgatagaggcccaagttgac
atgccagttgttggtgcagtaactttatatgtatcacttttgacatttactctccgtgtg
catccggatcggcttgattatgttgatcaagtgttgggtgcatgcgtaaagaaactttca
gggaatgcaaaacttgaagatagcagggcaacaaagcaaattgttgcacttctcagtgcc
cccctggagaaatatagcaatattgttactgcattagagctctcaaactatcctcgggtt
atggattaccttgataattctacaacaaaagttatggctcttgtaataattcaaagcata
atgaagaacacgacttgcatatctacttctgacaagattgaagctctttttgatttaatt
aaaggtcttataaaagatatggatggggctcaaaatgatgagcttgatgatgaggatttt
aaggaggaacagaattctgtggcgcgtcttattcacatgttgcacaatgatgaccatgaa
gagatgttgaagatattatgcaccgttcagaagcatatacttcagggaggtcccaagcgg
ctacctttcactgtgccatccttagtattctctgctctcaagttggtccgaagattacaa
ggtcaagatggtgatgtaataggggaggaagttcctgcaacgcctaagaaaatatttcag
atcttgcatcagaccattgaagctctctcatgtgttccttctcctgaactggctctcaga
ttatatctgcagtgtgcagaggcggccaatgattgtgatctggaaccggttgcttatgag
ttctttactcaagcattcatcttatatgaagaagaaattgcggattcaaaggctcaaatc
actgcaattcatcttataattggaacccttcaacggatgaatatattcggggttgaaaat
agagataccctgactcacaagacaacagggtactcagcaaaacttctaaagaaacctgac
caatgccgagcggtttatgcatgttcacaccttttctggactgacgaccaagacggaata
atggatggtgaaagggtcctcctttgtttaaagcgtgccttaagaattgcaaatgccgct
caacagatggctaatgtaacaaggggaagtagcggatctgtcgcgctatttatcgaaatt
ttgaacaagtatttgtacttcttcgagaaaggaattccagagatcacgaacactgtaatc
caggatttgattgaattgattaggacagagaagcaaagtgagaacactgtagctgatcca
tcgacagaggccttctttgcaagcactttacgttacattgaattccagaagcagaaaggt
gggagcataggtgaaaaatatgagcaaataaaaactacctga

DBGET integrated database retrieval system