KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334542
Entry
4334542           CDS       T01015                                 
Name
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP22
  KO
K09567  peptidyl-prolyl isomerase H (cyclophilin H) [EC:5.2.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4334542
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4334542
   03110 Chaperones and folding catalysts [BR:osa03110]
    4334542
Enzymes [BR:osa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     4334542
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    4334542
Chaperones and folding catalysts [BR:osa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    4334542
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 4334542
NCBI-ProteinID: XP_015631920
UniProt: Q0DMF1 Q7XZG9
LinkDB
Position
3:complement(33995691..33998700)
AA seq 204 aa
MASSGGAAISAGPTPPSAAAASSSVDWHLRPPNPKNPVVFFDVTIGSIPAGRIKMELFAD
IVPKTAENFRQFCTGEHRKSGLPQGYKGCQFHRVIKDFMIQGGDYMKGDGTGCTSIYGTK
FDDENFIAKHTGPGLLSMANSGVNSNGSQFFITCAKCEWLDNKHVVFGRVLGDGMLAVRK
IENVATGPNNRPKLACVISECGEM
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcgtcctcggggggagcggcgatctcggcggggcccacgccgccgtcggcggcggcg
gcgtcgtcgtcggtggactggcacctgcggccgccgaacccgaagaacccggtggtgttc
ttcgacgtgaccatcgggtccatccccgccggccgcatcaagatggagctcttcgccgac
atcgtccccaagacggcggagaacttccggcagttctgcactggagagcacaggaaatca
ggtttaccacagggatataagggttgtcagttccatcgagtgatcaaagatttcatgatt
cagggaggtgactatatgaagggggatggtactggatgcacgtcaatctatggtaccaaa
tttgatgatgaaaacttcattgcaaagcatactggtcctggcctactttctatggcaaat
agtggggtgaactctaatggatctcagttctttataacttgtgcaaaatgtgaatggctg
gacaacaagcatgtggtttttgggagggtgctaggggatggtatgcttgctgtgcggaag
atcgagaatgttgcaactggaccaaacaaccgaccgaagctcgcatgtgtcataagcgag
tgtggtgagatgtag

DBGET integrated database retrieval system