KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334554
Entry
4334554           CDS       T01015                                 
Name
(RefSeq) probable methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADH) [EC:1.5.1.54]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00670  One carbon pool by folate
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4334554
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.54  methylenetetrahydrofolate reductase (NADH)
     4334554
SSDB
Motif
Pfam: MTHFR
Other DBs
NCBI-GeneID: 4334554
NCBI-ProteinID: XP_015630556
UniProt: Q75HE6 Q10BJ7 A3AP03
LinkDB
Position
3:complement(34167930..34173340)
AA seq 594 aa
MKVIEKIQEAAADGRTVFSFEYFPPKTEEGLDNLFERMDRMVAHGPNFCDITWGAGGSTA
DLTLEIANRMQNMVCVETMMHLTCTNMPVEKIDDALTTIKSNGIQNVLALRGDPPHGQDK
FVQVAGGFACALDLVQHIRAKYGDYFGITVAGYPEAHPDAIQSTEGATPEAYSNDLAYLK
QKVDAGADLIITQLFYDTDIFLKFVNDCRQIGITCPIVPGIMPINNYKGFLRMTGFCKTK
IPAEITAALEPIKDNEEAVKAYGIHLGTEMCKKILATGIKTLHLYTLNMEKSALGILMNL
GLIEESKISRSLPWRPPTNVFRVKEDVRPIFWANRPKSYISRTLGWDQYPHGRWGDSRNP
SYGALTDYQFTRPRGRGKKLQEEWAVPVKSVEDINERFMNFCQGKLTSSPWSELDGLQPE
TKIIDDQLVKINQKGFLTINSQPAVNGERSDSTSVGWGGPGGYVYQKAYLEFFCSKEKLD
QLIEKSKAFPSLTYIAVNKDGESFSNIPTNAVNAVTWGVFPGKEIVQPTVVDSASFMVWK
DEAFEIWSKGWACLFPEGDSSREILDKVQKSYFLVSLVDNDYINGDLFAAFKEI
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgaaggtgatcgagaagatccaggaggcggcggcggatgggcggacggtgttctcgttc
gagtacttcccgcccaagacggaggaggggctcgacaacctgttcgagcggatggatcgc
atggtggcgcacggccccaacttctgcgacatcacctggggcgccgggggatccaccgcc
gacctcaccctcgagatcgccaaccggatgcagaacatggtgtgtgtggaaacaatgatg
cacctgacatgcaccaatatgccagttgagaagattgatgatgccttaacaacaataaag
tctaatgggattcaaaatgttctggctcttaggggtgatcctccacatggtcaggacaaa
tttgttcaagttgctggtggattcgcttgtgctcttgatttggtacaacacattagagcc
aagtatggtgattattttggtattactgttgctggttatccagaggcccacccggatgca
atacaaagtacggaaggggctacaccagaagcatacagcaatgatcttgcttatttgaag
caaaaggttgatgctggtgctgaccttatcattacacagcttttctatgacactgatatc
tttctcaagtttgtgaatgactgccgccaaattggcataacttgccccattgttcctggc
ataatgcctataaataactacaaaggtttcctgcgcatgacagggttctgcaaaactaag
ataccagctgagatcactgctgcactggaacctattaaagataacgaggaggcggtcaaa
gcatatggaatccaccttggtactgaaatgtgcaagaaaattttagctactggaatcaag
accttgcacctttacacgctaaacatggagaagtctgctctaggaatattgatgaacctt
ggattaattgaggagtccaagatctcaaggtcattgccttggaggcccccaacaaatgtt
ttccgtgtcaaggaggatgtccgccctatattctgggctaacagaccaaagagctatatt
tcaaggacccttggttgggatcaatacccacatgggcggtggggtgattcccggaaccca
tcgtatggagcacttactgactaccagttcactcgaccacgtgggaggggtaagaagctc
caagaggaatgggcggttccagtgaaatctgttgaagacattaacgagcgattcatgaac
ttctgtcaaggaaaacttacaagcagcccatggtctgagcttgatggccttcaacctgag
acaaagataatagacgaccaattggtgaagattaaccagaagggcttccttaccattaac
agccaacctgctgttaatggagagagatctgattcaacaagtgttggatggggtggtcct
ggaggctatgtttaccagaaggcctatcttgagttcttctgttcaaaagagaagctggat
cagctaattgagaagagcaaggcattcccttctcttacatacattgccgtgaacaaggac
ggagagtcattctcaaacattcccacaaacgctgtgaatgcggtcacatggggtgttttc
cctggcaaggaaatagtccagccaactgtcgttgactcagccagctttatggtttggaaa
gacgaagctttcgaaatttggtcaaagggttgggcttgcctgttccctgagggcgactca
tctagggagatactagacaaggtccagaagagctacttcttggttagtcttgtggacaac
gactacatcaacggtgatctcttcgcggcgttcaaggagatttga

DBGET integrated database retrieval system