KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334577
Entry
4334577           CDS       T01015                                 
Name
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4334577
   00562 Inositol phosphate metabolism
    4334577
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     4334577
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     4334577
SSDB
Motif
Pfam: His_Phos_2
Other DBs
NCBI-GeneID: 4334577
NCBI-ProteinID: XP_015629846
UniProt: A3AP28 Q84TX6
LinkDB
Position
3:34334736..34340089
AA seq 519 aa
MAAPRTPLPLVLLLVSAALLAAAPLSPAAETGAAAFDVRRHLSTVTRYDVARGSNSVSSA
PSMSDECRVIHLNLVARHGTRAPTKKRIKELDRLAVRLKALIDEAKQGPESDSLKKIPSW
MKGWESPWKGRVKGGELVSEGEEELYNLAIRVKERFQGLFDEEYHPDVYSIRATQVPRAS
ASAVAFGLGLLSGKGKLGPVKNRAFSVLSESRASDICLRFFDSCETYKDYRKRKEPDVEK
QKEPILEHVTSALVNRYHLNFTPKDVSSLWFLCKQEASLMNITNQACQLFNEAEVYFLEW
TDDLEGFVLKGYGESINYRMGLPLLKDVVQSMEEAIVAKEENHPDGTYEKARLRFAHAET
VVPFSCLLGLFLEGSDFAKIQREESLDIPPVPPQGRNWKGSVVAPFAGNNMLALYQCPGK
TDGGKISRDQKSSYFVQVIHNEAPVSMPGCGNKDFCPFEEFKEKIVEPHLKHDYDALCKI
RPVAREEPSSFSSRMSNFFLGLFSQKGYRVSAQDVKSEL
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggctgctccccgcacgcctctccccctcgtcctcctcctcgtctccgccgcgctcctc
gcggcggctcccctctcgccggcggccgagaccggtgccgccgcgttcgacgtccgccgc
cacctctccaccgtcaccaggtacgatgtggcgaggggatccaatagtgtgtcctccgcg
ccgtctatgtcggatgagtgccgcgtgatccacctcaatctcgtggcaagacatgggact
cgcgcacctaccaaaaagagaatcaaagagctggatagactggcggttcggttgaaggct
cttatcgatgaagcaaaacaagggcctgaaagtgactccctgaaaaaaattccttcatgg
atgaaagggtgggagtcaccctggaaaggtagggtgaaaggtggtgagctggtcagtgaa
ggggaggaagagctatacaaccttgctatcagagtcaaggagaggtttcaaggcctattt
gatgaggaatatcaccctgatgtgtattcaataagagcaactcaggttcctcgggcatca
gctagtgcagtagcatttggtttgggtctactttctgggaaagggaagcttggacctgtg
aaaaaccgtgccttttctgttctgagtgagagtcgtgcaagtgatatttgtctgcgattc
tttgatagctgtgaaacatacaaggactacaggaaaagaaaggagcctgatgttgaaaag
caaaaggaaccaattttagaacacgtcacatcggcattagttaaccgttatcatctcaat
tttacaccaaaagatgtttcttccctctggttcctttgcaagcaggaagcatctttaatg
aatataaccaatcaagcttgtcaactttttaatgaagctgaggtttattttctagagtgg
acagatgatctggagggctttgtgctaaaaggttatggtgagtcaataaactatcggatg
ggactgccattgctcaaggacgttgtccagtcaatggaagaagcaatcgttgctaaagaa
gaaaaccaccctgatggtacatatgagaaggcaaggctccgatttgcacatgctgaaact
gttgtccctttctcatgtcttcttggtctttttcttgaaggatcagattttgcgaagata
caacgggaggaatcattggacatacctcctgtgccaccacagggaagaaattggaagggc
agtgttgttgcaccttttgctggtaacaatatgttggctttgtaccagtgcccaggaaaa
actgatggtggtaagatttctcgggatcagaagagctcatacttcgtgcaggttatacac
aatgaagctccagtttcaatgccgggatgcgggaacaaagatttctgcccatttgaagag
ttcaaggagaagatagttgaaccccacctgaagcatgactacgacgccctatgcaagata
aggccggtggcaagagaggagccttcctccttcagttccaggatgtccaatttcttccta
ggtttgttctcgcagaaaggataccgtgttagtgctcaggatgtgaagtcggagctgtag

DBGET integrated database retrieval system