KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334604
Entry
4334604           CDS       T01015                                 
Name
(RefSeq) dolichyl-phosphate beta-glucosyltransferase
  KO
K00729  dolichyl-phosphate beta-glucosyltransferase [EC:2.4.1.117]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4334604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4334604
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.117  dolichyl-phosphate beta-glucosyltransferase
     4334604
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4334604
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 vATP-synt_AC39 Glyco_tranf_2_4 MHYT
Other DBs
NCBI-GeneID: 4334604
NCBI-ProteinID: XP_015628430
UniProt: A0A8J8Y8B0 Q10BK3
LinkDB
Position
3:complement(34498209..34501300)
AA seq 352 aa
MAAAGWPLSSSVADLLPASLSLTLLLASLVVVVVLAAAAFFFEHIRKIGCTHSLERTEVS
AAFFEDPNSLNKVRCPSIYDPAEKYISLIIPAYNEEHRLPEALTETLNYLKQRSAVEKSF
TYEVLIVDDGSTDHTSKVAFEFVRKHKIDNVRVLLLGRNHGKGEAVRKGMLHSRGELLLM
LDADGATKVTDLEKLEAQVRALAKKAESSLAPSSSPSQRLSDAEIAVFGSRAHLEKQALA
TRKWYRNFLMKGFHLVVLLTAGPGIRDTQCGFKMFTRAAARKLFTNIRLKRWCFDVELVY
LCKHLRIPMAEVSVNWTEIPGSKVRMTSILHMVFELLLIKVGYGLSIWKIYS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggcggccgccggctggccgctctcctcctccgtcgccgacctcctccccgcctccctc
tcgctcaccctcctcctcgcctccctcgtggtcgtcgtggtgctggccgccgccgccttc
ttcttcgagcacatccgcaagatcggatgcacgcactcgctggagaggactgaagtctcg
gccgctttcttcgaggaccccaactcgctcaacaaggttcgttgcccttcaatttacgac
cctgctgagaagtacatttcgttgatcatccccgcttataacgaggagcaccggcttcct
gaggctctcacagaaacactcaactacctgaaacaacgttcagctgtcgagaagtcattt
acttacgaggtcttgatcgttgatgatggaagtactgatcatacatcaaaagttgccttc
gagtttgtaaggaaacataaaattgataatgttagagttcttctacttgggagaaaccat
ggtaaaggcgaagcagtcagaaaaggcatgctccattcacgtggtgaactgttactcatg
cttgatgctgatggggcaactaaggttactgatttggaaaagcttgaagcccaggttcgc
gcattggctaaaaaggctgagtccagcctagcaccatctagcagtccatctcagagacta
tctgatgctgaaattgctgtttttggttcacgtgctcatctggagaagcaggctcttgcc
acaaggaaatggtatcggaattttcttatgaaaggtttccacctggtagttttattgaca
gctggtcctgggatcagagacacacagtgtggtttcaagatgtttactcgagctgctgca
aggaaactttttacaaatatcagattgaagaggtggtgttttgatgttgagcttgtatac
ctatgcaagcatctcaggatcccaatggctgaagtatctgtaaactggactgaaatacct
ggatccaaagtgcgtatgacaagcatcctgcatatggtatttgagctcctgctgatcaaa
gtaggttatggactgagcatatggaaaatctattcatag

DBGET integrated database retrieval system