KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334691
Entry
4334691           CDS       T01015                                 
Name
(RefSeq) flap endonuclease 1-B
  KO
K04799  flap endonuclease-1 [EC:3.1.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4334691
   03410 Base excision repair
    4334691
   03450 Non-homologous end-joining
    4334691
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4334691
   03400 DNA repair and recombination proteins [BR:osa03400]
    4334691
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334691
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     4334691
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    4334691
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     4334691
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     4334691
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4334691
SSDB
Motif
Pfam: XPG_I XPG_N 5_3_exonuc 5_3_exonuc_N
Other DBs
NCBI-GeneID: 4334691
NCBI-ProteinID: XP_015632894
UniProt: Q75LI2
LinkDB
Position
3:35046572..35052137
AA seq 412 aa
MGIKGLTKLLAEHAPGAAVRRRVEDYRGRVVAIDTSLSIYQFLIVVGRKGTEVLTNEAGE
VTSHLQGMLNRTVRILEAGIKPVFVFDGEPPDMKKKELAKRSLKRDGSSEDLNRAIEVGD
EDLIEKFSKRTVKVTKKHNEDCKRLLSLMGVPVVQAPGEAEAQCAALCENHKVFAIASED
MDSLTFGARRFLRHLTDLSFKRSPVTEFEVSKVLEELGLTMDQFIDLCILSGCDYCENIR
GIGGQRALKLIRQHGYIEEVVQNLSQTRYSVPEDWPYQEVRALFKEPNVCTDIPDFLWTP
PDEEGLINFLAAENNFSPDRVVKSVEKIKAANDKFSLGRGKLLAPVANLTGSTSTAGKEP
KCILGGPGQVMKARSPLQVCKSSSLNFIHDNSKAFMLGRRSGFLRISTYASI
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgggcatcaagggtttgacgaagctgctggcggagcacgcgccgggggcggcggtgagg
aggcgggtggaggattaccgcggccgcgtcgtcgccatagacaccagcctcagcatctac
cagttcctcattgtggtaggaaggaaaggaacagaagttctgaccaatgaggctggtgaa
gtcacaagtcatctgcagggcatgttgaaccgaactgttaggattctagaagcaggaata
aaacctgtttttgtgtttgatggtgagccacctgacatgaagaaaaaggaactggcaaaa
aggtctttgaagagagatggttcttccgaagatctaaatagagctattgaggttggagat
gaggatttaattgaaaaatttagcaaaaggactgtaaaggtcacaaaaaagcacaatgaa
gactgtaagaggctgttaagcttgatgggtgtccctgtagttcaggcaccaggggaggca
gaagcacagtgcgcagcactctgtgaaaatcacaaggtctttgctatagcttcggaggat
atggactctctaacttttggtgctagaaggtttcttcgccatttaaccgacctgagtttt
aagagatctcctgtaacagaattcgaagtgtcaaaggttttggaggaacttggactcaca
atggatcagttcattgatttgtgtatccttagtggctgtgactactgcgagaatattaga
ggtattgggggacagagagctttgaaacttattcgtcagcatggttatatagaagaagta
gtgcaaaatcttagccagacaaggtatagtgtcccagaagactggccttaccaggaagtt
cgggcattgtttaaggaacctaacgtttgtacagatattccagacttcctgtggacccca
ccagatgaggagggccttataaactttttggcagccgaaaataatttcagtcctgatcga
gtagtaaagtctgtagaaaagataaaggctgctaatgataaattttcccttgggcgaggg
aagcttttggcaccagtagcgaacttaacaggatctacatcaactgcagggaaggaaccc
aaatgtatcctgggtggtccagggcaagtcatgaaggctaggtcacctctacaagtgtgc
aagagctcaagcttgaacttcatacatgacaattcaaaagcgttcatgctgggcaggcga
tcaggatttctcagaatatctacatatgcttccatctga

DBGET integrated database retrieval system