KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334709
Entry
4334709           CDS       T01015                                 
Name
(RefSeq) mRNA-decapping enzyme-like protein isoform X1
  KO
K12611  mRNA-decapping enzyme 1B [EC:3.-.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4334709
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4334709
Enzymes [BR:osa01000]
 3. Hydrolases
  3.-  
   3.-.-
    3.-.-.-
     4334709
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4334709
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4334709
SSDB
Motif
Pfam: DCP1 WH1 mRNA_decap_C
Other DBs
NCBI-GeneID: 4334709
NCBI-ProteinID: XP_015629172
LinkDB
Position
3:complement(35168601..35174097)
AA seq 481 aa
MARGGSGGGRWRRLNVRPDLASDQEGTRTLNLTVLRRLDPAVADILIIAAHVVLYSFDDN
IHQWSRRPVEGSLFVVKRNTQPRFQFIVMNRKNTENLTEDLLGGFEYQVQVPYIMYHNAA
DEITGIWFYDPQECEQVGYLFSRIQKAFSRVSPKAKVSVTERNKILSSEYEKPEVVPAVP
SNEDTLKQPTSSIMLLDNAKYDFLSALLKGAACVGATMDEASAVQSNKSVGMVHSSTHAS
PHAIPPQSPAIQSNKSFGMVHSSTQAPLAIPPQSPAIRSNKSVGMIHSSTHASPFDIPPQ
SPAVQSNKSVGMIHSLTHASHLAIPPQSPALHGLHPSQISAVPVMPHDAHRSSSTSTIQP
TSLANPLFFPPMPSLQTASHAASSLCSAAPLHPPITVQQLQSAPLHQPFSLPTASSIQPP
YGMPLLQPFPPPNPSPFLTSGVSYGRPVITRDQLKDVLLSLCQNDEFIDMIYREFVKRQL
P
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggcgcgcggcgggagcggaggcgggaggtggaggagactgaatgtgaggcccgacctg
gcgagcgaccaggagggcacgcggacgctcaacctcacggtgctgcgtcgcctcgacccc
gccgtcgccgacatcctcatcatcgccgcgcacgtcgtcctctacagcttcgacgacaac
atccaccaatggagccggaggcctgtggaggggtcgctcttcgtcgtcaagaggaacacc
caacccagattccagtttattgtcatgaatcgtaaaaatacagaaaatctgaccgaagat
ctcttggggggttttgaatatcaagtacaagtcccttacatcatgtaccacaatgctgca
gacgaaatcacaggaatttggttctatgatcctcaggaatgtgaacaagttggatatctt
ttcagtaggatacagaaggcattttccagggtgtccccaaaggccaaggtttctgtaact
gaaaggaataaaattttgagcagtgagtatgaaaagccggaagtagtgcctgctgttcct
tcgaatgaggatactctaaaacagccaacgtcatctatcatgttgctggataatgcgaag
tatgatttcttgtcggctttgctaaagggtgctgcatgtgttggtgctaccatggacgaa
gcaagtgcagtacagtcaaacaaatctgttgggatggttcattcatctactcatgcgtca
cctcatgctattccaccacaatctcctgcaatacagtcaaataaatctttcgggatggtt
cattcatctactcaggcacctcttgctattccaccacaatctcctgcaatacggtcaaac
aaatctgttgggatgattcattcatctactcatgcatcaccttttgatatcccaccacaa
tctcctgcagtacagtcaaataaatctgttgggatgattcattcacttactcatgcatcg
catcttgctattccaccacaatctcctgctttgcatggtctgcatccttctcaaatttca
gcagttcctgtgatgccccatgatgctcatagatctagtagcacttctaccatccagcct
acaagtctagcaaatccgttgttctttcctccgatgccatctttgcagacagcttctcat
gctgcttcgtcattgtgttctgctgctcctcttcatcctcccattaccgttcagcagctt
caaagtgctcccttgcaccagcccttctccctaccgactgcatcgtccattcaaccacca
tatggcatgccattactgcagccatttccaccgcccaacccttccccatttcttacctcg
ggagtgtcttatggccgcccagtgatcacaagagaccaactgaaggatgtgctactgagt
ctttgtcagaatgatgaattcatcgatatgatatatcgggagttcgtgaagagacagtta
ccttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342837
Entry
4342837           CDS       T01015                                 
Name
(RefSeq) mRNA-decapping enzyme-like protein
  KO
K12611  mRNA-decapping enzyme 1B [EC:3.-.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4342837
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4342837
Enzymes [BR:osa01000]
 3. Hydrolases
  3.-  
   3.-.-
    3.-.-.-
     4342837
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4342837
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4342837
SSDB
Motif
Pfam: DCP1 DUF3772
Other DBs
NCBI-GeneID: 4342837
NCBI-ProteinID: XP_015644895
UniProt: A3BI93 Q7XHS7
LinkDB
Position
7:8316327..8321487
AA seq 382 aa
MAHGGGGRAKVTPNLAMDEEGTRVLNITVLQRLDPAVEDILITAGHVTLYDFDTNLNQWS
RKDVEGSLFVVKRNAQPRFQFVVMNRRNTDNLVEDLLGDFEYQLQVPYIMYRNAAQEVIG
IWFYNSQECEEVANLFSRILNAFSKATPKPKAPSIKSEFEELEAAPTLVEGPLEPQTSNI
IPATTHVQEDPLSAFFSGAINVGSASGLSVAGQLNQSFGSTPLSSHAPTSISISQPPAVH
HLLPSQTSSVISPDVHGGTGAVVNRSASLLNPSLFSPLTSSQTTMARTNPVAPTAPPQHP
RITQQPHSAPLLQPFPLPTASPSPPYGTPLLQPFPPPNPSPSLASAPVYSPVLSREKVRD
ALLRLVENDDFIDLVYREIVKG
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggcgcacggcggcggcgggagggcgaaggtgacgccgaacctggcgatggacgaggag
gggacgcgggtgctcaacatcaccgtgctccagcgcctcgaccccgccgtcgaggacatc
ctcatcaccgccggccacgtcacgctctacgacttcgacaccaacctcaaccagtggagc
cggaaggatgtggaggggtcgctcttcgttgtcaagaggaatgcgcagcccagattccag
tttgttgtcatgaatcgtcgtaatacagataatttagttgaagatctcctgggagatttt
gaatatcagcttcaggttccctatataatgtatcgcaatgctgcacaagaagttattggc
atttggttttataattcccaggaatgcgaagaagttgcaaatctttttagcaggatattg
aatgcattctccaaagcaactccgaagccaaaggctccctctattaaaagtgaatttgaa
gagctggaagcagcacctactttggttgaaggtccactagagcctcaaacatcgaatatc
ataccagctactacccatgtccaggaggatccgttatctgcattcttcagtggagctata
aatgttggcagtgcctctggtttatcagttgcaggacagttaaatcaatcttttggatct
actcctttatcttcacatgcaccaacaagtatcagtatatctcagcctccagctgtgcac
catttgctcccttctcaaacttcatcagtaatatcccctgatgttcatggtggaactggt
gctgtggtcaacaggtcagcaagccttctaaatccatcacttttttcaccattgacatct
tctcagacaacaatggcccgcaccaatcctgtggcacctactgctccacctcaacatcct
cgcatcactcagcaaccacacagtgctcccttgcttcaaccctttccgttacctacagca
tcgccttctccaccatatgggactccgttacttcaaccatttccgccaccaaatccatcc
ccatctcttgcatcagcaccggtgtacagcccagtactgtccagagaaaaagtcagggat
gcattacttaggcttgttgagaatgatgatttcatcgatttagtctaccgggagattgtg
aaaggatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349816
Entry
4349816           CDS       T01015                                 
Name
(RefSeq) mRNA-decapping enzyme-like protein
  KO
K12611  mRNA-decapping enzyme 1B [EC:3.-.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4349816
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4349816
Enzymes [BR:osa01000]
 3. Hydrolases
  3.-  
   3.-.-
    3.-.-.-
     4349816
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4349816
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4349816
SSDB
Motif
Pfam: DCP1
Other DBs
NCBI-GeneID: 4349816
NCBI-ProteinID: XP_015617840
UniProt: Q53QH1 Q2RAE7
LinkDB
Position
11:2565157..2568501
AA seq 380 aa
MPPPPPPQPQPTTTATTSANGGKVTPNLTMDAEGTRLLNLTVLQRLDPAVEDILITAAHV
TLYDFNIDLNQWSRKDVEGSLFVVKRNTQPRFQFIVMNRRNTDNLVEDLLSDFEYELQPP
YLLYRNAAQEVNGIWFYNQHDCEAVASLFGRILNAYAKVPPKPKVPSTKSEFEELEAVPT
SAAIDGPLEPSPATTTIVSDAPDESLVNYFSSAASIGSVSNAPMAGRAHPSSESVATPHV
PLIIPSATPTHQIPPPLVGSSAPPLPLHDTNVHTARSANLVTPAFFTPPSSSSTSMVPPA
SSMMPTAPPLHPTSASAQRATYGTPLLQPFPPPTPPPSLTPSYNEGPIISRDKVKEALLR
LVQNDQFIDLVYRELQNAHM
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgccaccgccgccgccgccgcagccgcagccgacgacgacagcgacgacgtcggcgaac
ggggggaaggtgaccccgaacctgacgatggacgccgagggcacgcggctgctcaacctc
accgtgctgcagcgcctcgaccccgccgtcgaggacatcctcatcaccgccgcccacgtc
accctctacgacttcaacatcgacctcaaccagtggagtcggaaagatgtggaggggtcg
ctgttcgttgtgaagaggaatactcagccgaggttccagttcatcgttatgaacaggcgt
aacacggataatctggtggaggatctattgagtgattttgaatatgaacttcaacctccg
tatttgttgtaccgcaatgctgcccaagaagtaaatggtatctggttctacaatcaacat
gactgcgaagctgttgcaagtctttttggaagaatactgaacgcatatgccaaagtgcct
ccaaaaccaaaagtgccttccacgaaaagtgagttcgaggaattggaggctgtgcctaca
tctgcagccatagatggtccccttgaaccttcgccagcgaccaccactatagtttctgat
gctcctgatgaatccctggttaattacttcagtagtgctgctagcattggcagtgtctca
aatgctccaatggctggaagggcgcatccatcctctgagagtgttgcaactccccatgtg
cccttgatcattccatctgctactccgacacatcaaataccccctcctttagtcggctca
tcagctccgccactgcccctccatgatactaatgtccacactgcccgttcagcaaatctt
gtaacaccagcattttttacgcctccgtcatcctcttctacatcaatggtgcctccagct
tcatccatgatgccaacagcaccacctcttcacccaacttctgcatctgctcaacgagca
acatatggaacccccctactccaaccttttccaccgccaactccacctccatctcttacc
ccttcatacaatgaggggcctattatttcacgggataaagttaaggaagccctcctgaga
cttgttcagaatgaccagttcatcgatttagtctatcgggagttgcagaatgcacatatg
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351547
Entry
4351547           CDS       T01015                                 
Name
(RefSeq) mRNA-decapping enzyme-like protein
  KO
K12611  mRNA-decapping enzyme 1B [EC:3.-.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4351547
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4351547
Enzymes [BR:osa01000]
 3. Hydrolases
  3.-  
   3.-.-
    3.-.-.-
     4351547
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4351547
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4351547
SSDB
Motif
Pfam: DCP1 CdiI_2
Other DBs
NCBI-GeneID: 4351547
NCBI-ProteinID: XP_015620671
UniProt: Q2QXH6 A0A8J8XCH8
LinkDB
Position
12:2780537..2783697
AA seq 374 aa
MRPPAPATTAGAGGKVTPNLAMDAEGTRLLNLTVLQRLDPAVEDILITAAHVTLYDFNIE
LNQWSRKDVEGSLFVVKRNKQPRFQFIVMNRRNTDNLVEDLLSDFEFELQPPYLLYRNAA
QEVNGIWFYNQQDCDAVAGVFGRILNAYAKVPPKPKVPSTKSEFEELEAVPTSAAIDGPL
EPSSSSTVLVSNAPDESLTDYFSGAVNVGNVSITPMVGRTHQPIESVASSHVPLIIPSAA
PTHQMGVPSGAASAPPLPVIDTNVHSSHSTNLVTPAFFAPPSSSSASLVAPASSFMPTAS
PFHPTSADAHRPAYGHGTPLLQPLPPPTPPASLTPVHNDEPVISRDKVKDALLRLVQNDE
FINLLYQELQNAHA
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgcggccgccggcgccggcgacgacggcaggcgcgggggggaaggtgacgccgaacctg
gcgatggacgcggaggggacgcggctgctcaacctcaccgtgctgcagcgcctcgacccc
gccgtcgaggacatcctcatcaccgccgcccacgtcacgctctacgacttcaacatcgag
ctcaaccagtggagccggaaggacgtcgagggatcgctgttcgtggtgaagaggaacaag
cagccgaggttccagttcatcgtcatgaacaggcgtaacaccgataatctcgtggaggat
ctattgagtgactttgaatttgaacttcagcctccgtatttgttataccgaaatgctgca
caagaagtaaacggtatttggttttataaccaacaagactgtgatgctgttgcaggtgtt
tttggaaggatattgaatgcttacgccaaagtgcctccaaagcccaaagtaccttccaca
aaaagtgagtttgaggaattggaagctgttcctacatccgctgctatagatggccccctt
gaaccttcttcgtcgtccactgttctagtttctaatgcccctgatgaatcattgactgat
tatttcagtggcgctgttaatgttgggaatgtatcaattacaccaatggttggaagaact
catcagcctatcgagtctgttgcatcctcacacgtaccattgatcatcccatctgctgct
cctacacatcaaatgggtgttccttcaggggctgcgtcagctccaccactgcccgtcatt
gacactaacgttcattctagccactcaacaaatcttgtaactccagccttttttgcacct
ccctcatcgtcttctgcatcattggtggcaccagcttcatcctttatgcccacagcatca
ccttttcatccaacttctgccgatgctcaccgtccagcatatggacatggtacacccctt
cttcaaccccttccgccgccaacaccacctgcatcacttacccctgtacacaacgatgag
cctgttatttcgagggataaagttaaagatgctctcctgaggcttgttcagaacgacgaa
ttcatcaatttgctctatcaggagttacagaatgcacatgcgtag

DBGET integrated database retrieval system